Alpha-amanitin-proprotein
General
Type : Natural || Toxin || Macrocycle || Peptide
Chemical_Nomenclature :
Canonical SMILES :
InChI :
InChIKey :
Other name(s) : MFDTNATRLPIWGIGCNPWTAEHVDQTLASGNDIC, Alpha-amanitin proprotein, H2E7Q5, AMA1-1, AEX26935
MW :
Formula :
CAS_number :
PubChem :
UniChem :
Iuphar :
Target
Families : S9N_PPCE_Peptidase_S9
References (1)
| Title : Characterization of a dual function macrocyclase enables design and use of efficient macrocyclization substrates - Czekster_2017_Nat.Commun_8_1045 |
| Author(s) : Czekster CM , Ludewig H , McMahon SA , Naismith JH |
| Ref : Nat Commun , 8 :1045 , 2017 |
| Abstract : Czekster_2017_Nat.Commun_8_1045 |
| ESTHER : Czekster_2017_Nat.Commun_8_1045 |
| PubMedSearch : Czekster_2017_Nat.Commun_8_1045 |
| PubMedID: 29051530 |
| Gene_locus related to this paper: 9agar-h2e7q8 |