Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: A85-Mycolyl-transferase

A85-Mycolyl-transferase


Genes:Proteins in A85-Mycolyl-transferase (194)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9acto-c0jrv0: Streptomyces sioyaensis Sio2, 1 reference(s)Streptomyces sioyaensis Show
MSPGVPRGWAPSSVLARAARGGSEVENGGKHMKILSRAGLRGWGAAFVGL
VALLGMVGPAAPAAQAATAPPHFADGFGLTVVSQPKWAGPEKRTFVVTVK
SRQVPTYDAMKGQVPGEHVLMVTLPTGYNGAAATRYPVLYHLHGAGDLPN
SLWTKTIAEHATKGVPLITVSPNGGGHGWYANWRNPGPRGRQNWETFHLK
QVIPFIDANLKTIAARAGRAIVGHSMGGFGAIHYAEDRPDLFRYAGSFSA
DLDLRSPWGRGAVVGSGVVPAYGKPYAAPDAIFGSPLWPLDGAWNAASPA
HHVTALRGMGVAMYSGDGGNLLDNPVQAAVEKGAQVTTATMAAHLKSSGI
PYRFVDYGDGSRWAKGCTGKHAQFPCLQADMNDYVKLIMKRLRHP
9acto-d3cyj3: Frankia sp. EUN1f Putative esteraseFrankia sp. EUN1f Show
MDTTPGTGPETTGTGPTQHAGNTGNTAPTDPPRDRRPRRLASQRRPSDGP
VSPKRHLDGSVASGRRSGGGRPGLPARLLAGALVLAAVGLAPGLTEAGPA
GPAGPAGPGTEAVAFSTGTSTTRVSAATLAARVPGTAVAPLTQVNRSVNG
GLNQLTGLVPATATMGVPNAGTVPVIGSVAAMADDGAYVAYESRVDDRTV
DLMIVSPALNGAAPVRVILPTGWAGSPAQTWPSLYLIHGCCEKADYQSWS
VFTNIRSFAADKQALVVMPSDGSAGFGTNWLNIGVLRKGWGYDTFLATEL
PQILQRGYRASGRAAIAGASVGGYAAFALSALHPGAYGAAASYSGVVDTI
GFLSSGLIQGLLVREGQISWAMWGDPVLFLGVWAKRNPADLITRLRGINL
YVSSGNGKPGPLDAAGATDDPFEMATNSNGQAFIRSANAGRLPVVTDFYG
NGTHSWKYWDRQLVRSWPTLAAGLGLPAA
9cory-c0dzu7: Corynebacterium matruchotii ATCC 33806 Putative uncharacterized proteinCorynebacterium matruchotii ATCC 33806 Show
MKLTRTLAATIAALSLFAATPHAAFASEVTPAQIAGNTPQSVIKVGKKEG
EDPAWRKKLDANDNRVTEMWATSPAMDNREVPLVVIKAADANRPVLYLLN
GADGGEGNANWIAQTDVINFYKEKNINVVIPMAGKFSYYTDWVSDSAKLG
GKQKWETFLTKELPSPLEKLLKGNGKRAIAGMSMSATSSMLLAEHNPKFY
DGVASFSGCYASSKPIPAEFVNVTLNRGGSSREQMWGPLGGPEWQRNDVH
VQAEGLRGSQIYVSNGTGLAGEWDMPNGPKLRKADPLVASVSSSILVVEG
GTIEAATNACTHDLKQKLESMKIPANFVLRNTGTHSWSYWEQDLRDSWPT
FEKAFS
9cory-c0e0l1: Corynebacterium matruchotii ATCC 33806 Putative uncharacterized proteinCorynebacterium matruchotii ATCC 33806 Show
KVVDKQDEFDGRVQRWSIQSPTMKRIVEVEVMAQPNAATPAPMLYLLDGV
SAPRVSGWFGPGDIINRLGNENVTVVAPTQGNGSFYADWSNTDPSLGYMK
WETFITEELPRVLEAPQADSRINFNGKRGIGGLSMGASGAVRIAAKNPNL
FHGVFGLSGCYSTVSQFGRTTIESTIKGQDGNPSNIWGPFGSSEWRANDV
TLHPEGLRSMPVFLSNASGKITKEQLQKDNGLPFYDTSLGATLEHVTLEC
TKDLEKVMDRNGMTNKKVVYIQSGIHRWNDTFTSQILPAWEYLKPSLQ
9cory-c0e5x9: Corynebacterium matruchotii ATCC 33806 Putative uncharacterized proteinCorynebacterium matruchotii ATCC 33806 Show
MKFMTRAIKKVAAAVTAVAAASVLAVAGQGVATAGPRDWLRPDATGACEW
DGVGFWVQRCDVFSPAMNRNITVQIQPAQRGGNAGFYLLDGARATERANA
WTTDSNAPELYANHNITLVMPVGGQGTFYQDWLRPANYTGDGPLFKWETF
LTKELPAYLEGNFGVARNNNSIAGLSMGGTAALNLAARNPAMFKQAMSWS
GYLTMSGPGMSTLVRLAMLDLGGFNVNNMYGSMFNPNRYENDPFWNMGAL
RGKDVYISAASGFWSADDIMRYEVKDRITGSILEAFSLYTTTLWEAKARA
EGVNVTVNYPAAGIHNWLQWNYQLNLTKNRVLDVMQAW
9cory-c0e5y0: Corynebacterium matruchotii ATCC 33806 Putative uncharacterized proteinCorynebacterium matruchotii ATCC 33806 Show
MTDYLDTNAVERTPIRVDERPQINGLPDGVSVERVKWITDRRIELQIKSK
VMPKDVVKVQMLLARDWHSQPNRKFPEVWALDGLRATDIESGWTSETNIE
QLFADKNVNVILPVGGESSFYSDWQSEDNGKHYMWESFLLNELIPVLKNG
YRANGDRAIFGLSMGGTAAMNLAERNPDLFKFVGSFSGYLDTTSPGMPDA
IRTAQQDAGGYHSEAMWGPDGSQQWIDHDPKLGIKALKGMKVYVSAGSGR
DDFGQPGSVAKHPANAAGIGLEVISRMTTQTFVDFARRDGVEVTSVFRPS
GVHDWPYWQFEMGQAWPHIAGALNL
9cory-c0e429: Corynebacterium matruchotii ATCC 33806 Putative uncharacterized proteinCorynebacterium matruchotii ATCC 33806 Show
MRILGGIVVAGVSAGLNLGVMPAGATDVGDLGSSSAVERMSKDPRLAPEL
ERLLGSTPGYVPTPPIYFRPNPYPPASLRDYAAPRLAKREADAQHPGIER
LFVESPAMRRVVQVQVQHAKDRGRPAPMLYLLDGVTAPKESGWLREGNVQ
QLSGEQVTAIMPTEATGSNYTNWQSDDPILGRMQWETFLTSELPTVLERE
ADLKFNGTRYIGGVSMGGSAAVRLANLHPDLYRGTFGFSGCYSPTSTDGR
GFLNLINTATGGNPDNQWGPGVSAERRRNDVTANPSGLRGMPVYLFAADG
EVTQRDKDIVAKDGGPITLTGSVILEKLVNQCTHDLDDAMRAQGMTHQQV
TYLHGGTHNWPYYAEQLPIAWRHISGGGR
9cory-c0e430: Corynebacterium matruchotii Putative uncharacterized proteinCorynebacterium matruchotii ATCC 33806 Show
MAYKNVHQFMGNKTQAIVMTIVATVTVLTTGFGSFEPMVAGAQPASFSLS
PMQDPLVEASRNPQLARALQDAYEAAHRGQPGYVQVPPVYLRPNPYPAAS
LRDYAAPRLAKREPDGYEPNVERLFVESPAMRRVVQVQVQYAKDRSKPAP
MLYLLDGAASNDTSSWLTEGRVQQLHQDAQVTVVMPTEARSSNYANWQAD
DPMLGRMQWETFLTRELPTVLEKEADLKFNGARYLGGASMGAGAAVRLAS
LYPDRYRGTFGLSGCYSTTSNMGREFLNMIVAAGAGNPHNQWGAGTSAER
LRNDVTAHPEGLRNMRVYVFTADGVITPRDRSITAKYGPVGNAAIPSSVV
LEKMSNECAHELDDAMRARGMTHQKITYQQGGIHFWSYFAEQLPIAWRHM
SQ
9cory-c0e434: Corynebacterium matruchotii ATCC 33806 Putative uncharacterized proteinCorynebacterium matruchotii ATCC 33806 Show
MATRRYCTLVAAVLNTKTARKLISFGVKMVQKSPAVWRRIPPIYIDETAH
PVTSNQDYDVPRLAKRVFDEAPRVERWFIESPCMRRIVEVQVMLPPRPEE
PAPMLYLLDGVTAPRRSGWLREGQLEKGLNNEQVIVVMPTEASGSLYENW
VADDPEVGRHQWDTFLTQELPNIMEDPTTGLKFNGRRIIGGLSMGASGAI
RLAAKHPEFYHGAIGLSGCYSTTSAMGRGMTLAILRCVGSDPDNAWGTGP
TPTWARNDVADHPEGLRNIPVYLFAADAHITKYDIELHTGRTRLDLPGAT
ILEYASYTSTRDLERAMINAGMTHQVVHYQYGGVHAWEYYGDQLKAGWDA
VYKSQVS
9cory-c0e717: Corynebacterium matruchotii ATCC 33806 Putative uncharacterized proteinCorynebacterium matruchotii ATCC 33806 Show
MPLVVTPAVSAQQTSAAPSSAAAAASTSAAAPASAEPSAAATSAAKAAEE
QGSNGSSLSSDSGLQPNTNATPGANFTGQKSQIEENPSWILSENKFADKA
WAGDLDRYSKYTDSQGRKRVVAMAATSPSMNNAKIPLGIIRAKDANRPTM
YLLNGAGGGEQSTNWMTFDSAIRFYLDRNVNVVVPMRGAFTYYIDWYDKK
GAKGEAYIDGPQNWETFLTKELAEPIEQTLGSNGQRGIVGLSMSATSSLL
LAARNPGFYKAVGSYSGCASTSRPIPYMFASITLQREGISPRQVFGPMGG
SYNTEHDALVKAEGLRGSAIYVSNATGLMSQNETFNKLRKEGAESAAAAN
TSSDIVVQGGLIEGATNACTHDLRAKLNGLNIPADYKFRNTGVHTWYYWL
DDMRESWPTFARGFGLENELASVPDKSNYPDPQK
9cory-c0vrd2: Corynebacterium glucuronolyticum ATCC 51867 Antigen 85 proteinCorynebacterium glucuronolyticum ATCC 51867 Show
SMNGRSIPLVVIHAKDPGRPTLYVLNGGDGGEGSANWIMQTKMIDFYKDK
NINVVVPMEGKFSYYSDWVNEKKNLGGKQMWETFLTKELPPVIEKELQAN
DKRAITGMSMSATTVLLYAQHHPGFYDAIGSFSGCAQTNDSMGRIAIDLT
LERASSNVNEMWGNGEAFQPGFLDKPVDNYLQYNDALVNAEKLRGQTMYI
SNASGLSGRWDYWSSPRTKGNSAAMAEVEVVGGVIEGATNFCTHQLKAKL
DKAGIPAEWNFRPTGTHQWGYWEDDMHLSWPTLAKGLGIENELNS
9cory-c0vwv6: Corynebacterium glucuronolyticum (strains ATCC 51867; ATCC 51866) Secreted antigenCorynebacterium glucuronolyticum Show
MRKLMRRAVAAIMAFVLAVTVTPAAQAANRDWLRNDSTGQCEWDRAQNWV
QYCTVWSPSMEKHIPVHIQPAIRGGNAGLYLLDGMRALPDRSAWTTDVNA
AELFVDSNITLVMPAGGAGSFYSDWDGPATFNFKQPVKYRWETFLTQELP
SYLETNFGVARNNNSIAGLSMGATAAISLAAKHPDQFRQAISWSGYLTTT
LPGMQSLLRLALLDVGGFNILTMYGSTINPRRFENDPFWNMGGLKNTDVY
ISAGPGIPGPADAGYPTGQKISGALLEWFSAYSTTLWETKARATGLHVTA
DYPKTGLHNWMNWRDQMIRTKPRILDVMNAW
9cory-c0wgb2: Corynebacterium accolens ATCC 49725 Secreted antigenCorynebacterium accolens ATCC 49725 Show
MTASIRGRVLSVIMAVAVALGLAVVAGGTQQAHAAHRDFLRADNTGTCEW
DQVGWWVQRCDVWSQSMGRNIPVQIQPAKNGGNAGLYLLDGLRATDRTNA
WVNDVNAARTYEPHNITLVMPVGGESSFYADWQAPAKYDPNEPVNYKWET
FLTSELPAYLESNFGVARNNNSIAGLSMGAGSALTLAAKHNDQFRQALSF
SGYLTTTVPGAQTFMRFAMLDAGGFNINAMYGSLFNPKRFQNDPLLLIPQ
LRNTDVYISAATGIPGDLDRQRYLPEHQAAGAALEVGSRITTHVWEGAAR
LQGLNPTVDYPAQGLHNWLQFGYQLEKSKPQVLNVMNAW
9cory-c0wgb3: Corynebacterium accolens ATCC 49725 Trehalose corynomycolyl transferase CCorynebacterium accolens ATCC 49725 Show
MRKNTSPGKARKGLAVAAVPTAIAVGLALLPNATAQSSLGDISSAQPGGG
GSLSDHFAPKDPPARTPVETEYPEVEGLPDGVKINRVEYLSNRHLMVYIK
SAAMPDQEQKVQIQLARDWYSQPEKKFPEVWALDGLRARDDESGWTIETN
ILNQYADRNVNLIMPVGGESSFYSDWQQPDAGKNYKWETFLTKELVPILD
KEYRSNQKRAVTGLSMGGTAAINLAERNPYLFGFVGSFSGYLDTTTRGMP
QAIMAAQRDAGGFDSRKMWGEPASQDWIDHDPKLGIENLKDMQVYVSAGN
GKDDFGNATSVAKGQASLAGMGLEVISRMSTQTFVDYAKRANVEPVVQFR
PSGVHSWEFWQFEMQNAWPYIADALN
9cory-c0wi14: Corynebacterium accolens ATCC 49725 Antigenic 85 complex proteinCorynebacterium accolens ATCC 49725 Show
MKRLNSVLAAAAVCTGLAYAPVAGAAELTPQQVAGDAAQSTISPLEPTPE
IEGKSWYKKYKDDARVEKLEATSPAMNGRKIPLAVVRAQHENRPTVYLLN
GAGGAEQDMDWLKLSDAVDFYHSKDVNVVVPQAGAFSYYTDWISEPNSGF
LQGPQKWETFLTKELPGAIEKHINADNHRAIAGMSMSATSSLLLAQHNQG
FYDAVGSFAGCAATAYPIERQGVELTVGRGGGSVDQMWGPLGSPTNRYND
AMMNAEKLHGTELYVSSGSGLASEEDTFSYIQSKGYNPLQAAQGSATLQV
EGGAIEAGVNYCTHNFKAKLDQAGVPATFNFRNTGTHSWPHWNQDLKDSW
PVFERGFNS
9cory-c0xnr5: Corynebacterium lipophiloflavum DSM 44291 Secreted antigenCorynebacterium lipophiloflavum DSM 44291 Show
MMALLVIATMAASMVVAAPKAHAANRDWLRPDATGTCDWDPVAFWVQRCD
VWSDSMGRNIPVQIQPAARGGNAGLYLLDGLRATDYTNAWLSDVNAAQTY
VDSNITLVMPVGGKSSFYADWRAPATYDFNNPVVYKWETFLTSELPGYLQ
QHFGVAPNNNSILGLSMGGTAAMNLAAKHPDQFRQVLSFSGYLATTIPGG
QTALRLALLDGGGFNINAMYGSILSPERFENDPFLNMDGLRNSDVYVSAG
AAVPGPGDAGYLPQHIASGVALEAYSNFTTRLWGLKARASGINFTEVYTP
TGVHNWVQFGSQLEATKPRVLDVMNAW
9cory-c0xnr8: Corynebacterium lipophiloflavum DSM 44291 Trehalose corynomycolyl transferase CCorynebacterium lipophiloflavum DSM 44291 Show
MDRNPQIPGLPAGVSVDRIEWLTNRRVAVFIKSAAMPEQLMQVQILLARD
WHSNPEATFPEVWALDGLRARDDENGWTIETNIEQFYADKNVNVVLPVGG
ESSFYSDWQRPNNGKNYKWETFLTKELVPILDNEFRSNGKRAVVGLSMGG
TAAMNLAERNPHLFDFVGSFSGYLDTTTTGMPQAIQAAQMDAGGYDSLAM
WGPVGSQDWIDHDPKLGIENLKDMTVYVSAGNGRDDYGQPDSVANGPANL
AGVGLEVISRMSTQTFLEYAARTSVKPIVHFRPSGVHSWEYWQFEMSQAW
PYIAD
9cory-c0xpm2: Corynebacterium lipophiloflavum DSM 44291 A85 antigen family 85 complex proteinCorynebacterium lipophiloflavum DSM 44291 Show
MPTLIVATLGGGVLGSALYEGIGSTGSALSSALTDAAPTFPAADAAPAQL
RSLRHIEGDVYELVVWSGAMQREVTNEIILPGGPDNTAPRPRFYLMMGAD
GAAGGLSWRTMSNYEEFFAGKNVNVVTPLGSVSSMQADWYRPDPVTGTNK
WLTYMTRELPPLIDATFNGAGRDAIAGISMSGGPAISIASYDPQRFVAAA
SYSGCPSTTGLLGGVHASSAVAMNGGNPVLMWGLPGNEAWGAHSPVLHLD
NLHNTALFVSAAQGVPGPIDGIDNSSQRVANPMLIEGASYACSLYFAQQA
RAEGLDVTWYETVEGTHTWGLFEKLMRESWGTIGPALGVN
9cory-c0xpm4: Corynebacterium lipophiloflavum DSM 44291 A85 antigen family 85 complex proteinCorynebacterium lipophiloflavum DSM 44291 Show
MSLEHVRDNLYTLTVYSPSMQRNITNDLVLPAGGTDNTTPRPTFYLLGGA
GGGGWTGEGGAPDFFRDKLINVVTPRGAIGSQQADWAQEDPKLGLYKWTT
YLTKELPPLIDAAFHGTGNDAIAGMSMSGGPAMHIATMDDRFKVAGSYSS
CPSTTGVLGQAFASSTVRFYGADPANMWGSSADPAWAAHSPILNLEDMRD
LKLFAAASRGVPHETDQEVKDSPAPLLVVDEQFNYTCTRYFVDESREAGL
SIDFYEFDEGTHNWGLFRRQLRETWKTIGPALGVE
9cory-c0xrb3: Corynebacterium lipophiloflavum DSM 44291 Antigen 85-ACorynebacterium lipophiloflavum DSM 44291 Show
MTPKSAASRRARFTARFTAAVCTAALGATLPAVASAQMPNPLSSMSSTGS
STGGSSGEDAPLVTREQPAVQPAQIFTEPSRELTAEELWAIGNRGVEYAE
AYSPVMGRRESMLIARPKDPALRDNAPTIYLLNGLDAGTGWFAYTDAAEF
YTSRGVNVVMITSGAFSYYTNWIQGPDQWDTFLARELPLGIESYLGANGK
RAVMGVSMSATSALSLAQNNPGVYNGVASISGCASTTSPLGKVGVDAVFA
SAHIPLEFEDVWGDPNGEYARSYDPMLNLNKLSPEFQGQNLDIFISSPSG
LAGMESLTTGNIVDPGNKDLALNFVTIGGRTDLASNICTHVLDQRLNMRG
IDHEARFYPQGTHNWNSFRWAVADSWPTLSRGLGKQP
9cory-c0xub1: Corynebacterium lipophiloflavum DSM 44291 Antigenic 85 complex proteinCorynebacterium lipophiloflavum DSM 44291 Show
MNLKRSVLAATAALSLALGAAPLTPAANAADVTPEHVADGAAVGEVKPWD
VNAEPPLVVSTKKPQDWIKQVDNKSVLAYKVFSPSMERDIPVAVIPATDA
NGERVNNAPTIYLLNGAGGAEQNADWLKMYDTRDFFTGKRVNVVIPQAGA
FTYYTDWLDENVKSPYINGPQKWETFLTKELPGPIEKTLNADNRRAIVGF
SMSGTSALVLPAHNPGFYDAAASFSGCAATSSPHAYNFARVTINRASGTG
DFKTVTPEQMWGPMGGEYNRYNDALLNADKLRGTALYISTATGLAGRSDQ
VSYLIGQGAPAPAASVGATTLQVEGGVIEAAINKCSHDLRAKLESEGIPA
TYEFRNVGTHSWPYWREDIEKSWYSTIAPAFDM
9cory-c2gdp1: Corynebacterium glucuronolyticum (strains ATCC 51866 ATCC 51867) Trehalose corynomycolyl transferase CCorynebacterium glucuronolyticum Show
MSSRLRYLAYPLALSLLITPVAGAQSSFPSVPNQPGLSDYLQDDVPQRTP
IRTDYPEIKGLPDGVSVDRVEWITDRRIAVFIKSAAMPGEPVQVQMLLAR
DWYSNPAKSYPEVWALDGLRALDTENGWTINTNIEQMFADKNVNVILPVG
GESSFYSDWLKENNGKNYKWETFLTQELPAVLKQGYRSNGQRAITGISMG
GTAAMNLAQHRPDMFNFVGSFSGYLDTTSPGMPLAIRGALSDAGGYDATA
MWGPDGSQQWIDHDPKLGLDALKGKTVYVSSGSGKDDFGEPGSVATGPAN
PAGIGLEVVSRMTTQTFVDRANRAGLEVISQFRGSGVHAWPYWQFEMVQA
WPYIAD
9cory-c2gg83: Corynebacterium glucuronolyticum ATCC 51866 AntigenCorynebacterium glucuronolyticum ATCC 51866 Show
EKFYVYNTGSNDPQVSVYQATSPSMNGRSIPLVVIHAKDPGRPTLYVLNG
GDGGEGSANWIMQTKMIDFYKDKNINVVVPMEGKFSYYSDWVNDKKNLGG
KQMWETFLTKELPPVIEKELQANDKRAITGMSMSATTVLLYAQHHPGFYD
AIGSFSGCAQTNDSMGRIAIDLTLERASSNVNEMWGNGEAFQPGFLDKPV
DNYLQYNDALVNAEKLRGQTMYISNASGLSGRWDYWSSPRTKGNSAAMAE
VEVVGGVIEGATNFCTHQLKAKLDKAGIPAEWNFRPTGTHQWGYWEDDMH
LSWPTLAKGLGIENELNS
9cory-c6r7h6: Corynebacterium tuberculostearicum SK141 Antigen 85-CCorynebacterium tuberculostearicum SK141 Show
MTASIKGRVLSVIMAVAVALGLAVVAGSQPAEAANRDWLRRDATGTCEWD
KVGWWVQRCDVWSQAMGRTIPVQVQPAKRGGNAALYLLDGLRATERTNAW
VNDVNAAKTYEPHNITLAMPVGGAASFYADWQGPATYDLENPVNYKWETF
LTSELPGYLERNFGVARNNNSIAGLSMGAGAALTLAAKHPNQFRQALSFS
GFLTTTVPGAQTFMRLAMLDAGGFNINAMYGSLFNPKRFQNDPLLLIPQL
RNTNLYISAASGVPGAGDAHYLPEHQAAGAALEVGSNITTRVWEGAARLQ
GLNPTVDYPAQGLHNWEQFGYQLNRSKPQVLNVMNAW
9cory-c6r7h9: Corynebacterium tuberculostearicum SK141 PS1 proteinCorynebacterium tuberculostearicum SK141 Show
MRKSTSPSKARKGLAVAAVPTAIAVGLALLPNATAQSSVGDLSSAIGGDS
SLSDHFAPKDPPARTPLNTEYPDVKGLPEGVKINRVEYLTNRHLMVYIKS
AAMPDKEQKVQIQLARDWYSHPEKKFPEVWALDGLRARDDESGWTIETNI
LNQYADRNVNLVMPVGGESSFYSDWEQADRGKRYMWETFLTKELIPILDN
EYRSNHKRAVTGLSMGGTAAMNLAERNPHLFNFVGSFSGYLDTTTRGMPE
AIMAAQRDAGGYDSRKMWGEPGSQNWIDHDPKLGIENLKDMKVYVSAGSG
KDDFGNANSVAKGQANLAGM
9cory-c6r7q5: Corynebacterium tuberculostearicum SK141 Cell surface protein ACorynebacterium tuberculostearicum SK141 Show
MKRLSSILAATAVCAGLACAPLAGAAQLTPQQVAGNAAQSTLAPLEVTPE
LEQLTWYQKYKDDPRVEKLQATSPAMNGRKIPLAVIRAKDENRPTIYLLN
GAGGAEQDMDWLKLSDAVDFYHSKNVNVVIPQAGAFSYYTDWVSEPNSKY
LKGPQKWETFLTKELPGAIEGHIKADNHRAIAGMSMSATSSLLLAEHNQG
FYDAVGSYAGCAATAYPVEHKAVELTVNRGGATAEQMWGPFGSPTNRYND
AMMNHEKLRGTELYISSGSGLAGKEDTFSYNVAKGYNPATAALGSAQLQV
EGGAIEAGVNYCTHNFKAKLDQAGIPATYNFRNTGTHSWPHWIADLKDSW
PVFERAFNK
9cory-c6r7q6: Corynebacterium tuberculostearicum SK141 Cell surface protein ACorynebacterium tuberculostearicum SK141 Show
MHTLRSIGSSVAGIAIAAGVLSAPIASAVEPAEIQGDATLSTIREVNLTD
PADPENINYAITTEGNNRVVDIAGLKDKDKWKGYAFGHKSGQGKHYGNHV
KVMTATSAAMDGREVPLAVITPDGDFDKQRPTLYLLNGAGGAEQGMDWLT
ATANHDIDPEAEGVQDMVDFYTSKDVNVVIPQAGAFSYYTDWVSSPNSGY
LKGPQKWETFLTKELPGALEDHIGGNGKRAIAGMSMSATSSLLLAEHNPG
FYNAVGSFSGCAATSRPLPRLYTQLTVNRGGGSADQMWGAMGSEYNVYND
ALVNANPNNLGKSETYVSVNSGLGGANDWGVPGSSTLIVEGGVIEAAMNS
CTHDLKAKMDSQGMKADWNFRNTGTHSWPGWRNDLFTSWATFERGFAKDA
AEAPAEPEVKPNELSIDAPQAEEDAQVKDAPSAADQSPDKDFVEGKDAEG
AEAAGAAEAAGVAE
9noca-q06gc0: Rhodococcus sp. NS1 Putative esteraseRhodococcus sp. NS1 Show
MRGVDVRSRASMGTRRARMLAAAVAAMMLVPLGGGVASAQDRESDPIVAS
QGLLADPVAPNGSRIVSSEIDGQYLTVQVYSAAMDTTIPVRVQRPHDASE
PRPVLYLVNGAGGGTDSATWWANTDVGEFLTGQNVNVVMPLGGAFSYYTD
WKREDPQLGMNKWQTFFLDELPPLIDAALDTNGVQAIAANSMTATAVLQY
AIAKPGFYSAVAGYSGCAQTSDPVGREFVKLVVETWGGGDVRNMYGEDDD
PAWVANDPVVNAEGLRGTRLFISDATGLPGPHDTLGNEFTIGEQDAALDQ
QGLALANQVVVGGVIEAAVHWCTTNLQTRLRELDIPATFDLQPAGTHSWG
YWQDAFHRSWPLLAEELGLPQPQ
actmd-c6waq3: Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / NBRC 14064 / IMR3971) Putative esterase, 1 reference(s)Actinosynnema mirum Show
MTPHRRIAAALALAAVMAPAPAATAAQPAPEPPHLTDGHGLTVVEQPAWL
DGGHRSFSFAVRSTQVPTPTLMTGQKPGQHTVVVTLPEDYDPSGTTRHPV
LYSLHGNQDRPDSPWNRQLAERATAGTPLITVQPNGGRSWYSNWVNPGSL
GPQNWESFHLDQVIPFVDANLRTIAAREGRAIAGHSMGGFGAFHYAEHRP
ELFGHLGSFSGGLDLLDQAQRVAVVETALNPASGVPTIGADTVFGPPVWP
LDGVWNAQSPAQHVASLRGVGVAMYVGSGGDLLDNPVQAVVENRARRTNL
AAAANLRAAGIAHDFVDYGDGSGWARGCTGKHAQFACLQADWDHFVGLLV
ARSRQW
actmd-c6wnr8: Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / NBRC 14064 / IMR3971) Putative esterase, 1 reference(s)Actinosynnema mirum Show
MVRALTLFLILLLAACTTAGPSAPTGPTGTTSTTTSATADPSGRVVDLVL
PSTALGRDAQVRLLLPDGWAAQPDRRWPVLYLLSGCCGSHLGWTSPGQAD
RLTRDLDVIVAMPEGGLAGFYTDWAEGPAWETFHLVELREALERDYRAGG
DRVVAGYSMGGFGALSYTARHPGFFRAAASFSGVVHTTGTDDSRALVRRI
VTQADLDPAALWPADADWAAHNPHDLADALRGVPVYLSCGDGAPGPLDSP
GNEVVDALEAELWAENLATTARLTEAGAQVTADLYGPGTHTWPYWDRALE
NALPILTAALPG
cora7-c3peg4: Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1 (Corynebacterium nigricans)) Putative esterase, 1 reference(s)Corynebacterium aurimucosum Show
MHFSRTALAGLLSVGLILSPTHAQPAHAQAPDAMSSDIANIDQHSSALDP
IALGPLAPVLFADNIFAAWGRLLQQVRIPTVAPEATRPPATTAPAQLREL
RHIQDNVWELKAYSPAMDRVITNDIILPLGGLENTQPRPTYYLLGGAGGG
EDALWWDGGGASEFFRDKHVNVVSPRGAYGSMMSDWAQPHDTHGKYKWAT
YLTKELPQLIDAKFHGNGRDGIAGVSNSGGPALELATFDPRFKVAGSFSG
CPSTTGILAQSFAWVSAAFYGTDPARSFGAPWDPAWAQHSPVLNLDHQKG
RKTFVIVSRGGPADFDIDIEDSPLPALGLNERLDYWCSAYYAKRATAAGV
DLDYYELPAGRHTWGLFRRELAISWATVGPALGVN
cora7-c3phx8: Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1 (Corynebacterium nigricans)) Putative esterase, 1 reference(s)Corynebacterium aurimucosum Show
MKLLSALLSSALLMSSAPAYQESSRDEQSSRWGVDATFSIINAMGSSSHL
LTDLFTSKQEGYPYPVDASISTASVVSRTPTDEPGREKWMVASPSMGREI
PVDVVVGNGGPVVYFLEGVDSPETSNWITKGHLKRVFGDSDASIVIPSQG
AGSMWTDWNQDDPKLGRHKWNTFVTQELAPVVEAELNHNGKRGIIGLSMG
ASGAVMMANNHPGFFDAVAGISGCYSTTSTVGQGTVDLTVGSLGGNPRNM
WGPHGSPDWVRNDVAANPAGLRGTALYLSAASGAWSDEEMAAYANKSLDD
RIGGTLLEAGSKRCTEEFSAALDDASLPHTTDYLDTGVHDWVMFGKQLQP
AWDAIKPALY
cora7-c3piw1: Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1 (Corynebacterium nigricans)) Putative esterase, 1 reference(s)Corynebacterium aurimucosum Show
MLSFVSRSRRAAALVAAAMVALGTASASIGSASAQSSTIGEVSSRVTNPQ
PWLGDKAFITAKRHMGGNHWVVDVWSPANHAVISNNVLLPEGDKPRPSFY
LLPGVEGGQAGMNWMTHSDIRHWAVGKNVNVVMPLGGAYSLYTDWNAEDP
ILGVNKWNTYMTAELPPLIDAEFHGTGRDAIGGISSTGGAALDIAGHAPQ
RYKAAASYSGCPVRSGAIGFPTSTAMIAYGGGSSFNAWGLPGSPQWFEHD
PNANPGRLRDVEVFVGSASGTPGPIDGTNSPAQLLGPRAVEMVANQCSEE
FTRNARNAGVRVNRYFSPQGSHTFNLFSHQMKLSWDQTIARTIGA
cora7-c3pjx9: Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1 (Corynebacterium nigricans)) Trehalose corynomycolyl transferase A, 1 reference(s)Corynebacterium aurimucosum Show
MKRLSSLLAAGALSAAALVSPVAGAATLTPQQVAGDTALSTISDLQVTPE
VESQKWYGKYKDDPRVLKLEATSPAMNGRSIPLAVISAKNPDRPTVYLLN
GAGSAEQDSDWLHMSDAVDFYAEKDVNVVVPQAGAFSYYTDWLEEPNGKY
LKGPQKWETFLTKELPGPLEERLNANNKRAIAGMSMSATSSLLLAQHNQG
FYDAVGSFAGCAATAYPTEYEFLRLTVNRGGGQPEQMWGPMGSAYNRYND
ALMNSEKLRGTKLYISSASGFAGEQDTPSYYINKGYSPLTAYMGSAQLQV
EGGVIEAAVNHCTHMLKAKLDKQNIPATYNFRNVGTHSWPGWREDLVKSW
PTFEEAFNS
cora7-c3pjy0: Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1 (Corynebacterium nigricans)) Corynomycolyl transferase, 1 reference(s)Corynebacterium aurimucosum Show
MPLHFRSSSRKRDSMKIARSLTTLAAASALALGAVVSPIASASDIDPAQI
RGEATPSDISDIDLYTELEEYLPKDGAGNPTPSREQFEASFDKKVSYPDV
KISNLPEEKKWMGYVFKYWDYRHKVKALNATAPAMDNREVPLAVITPDGN
FDASRPTLYLLNGAGGAEQGMDWISSTIAKDLDPDTPDVQDLVHFYANRN
VNVVIPQAGAFSYYTDWLSTPDRGYLKGPQKWETFLTKELPGPLEKRING
NGKRGIAGMSMSATSSLVLAQHNPNFYDAIGSYSGCAATSTPLPNFYAQL
TVNRGGGSTEQMWGAKGGDYNRYNDGLINATKNNMGNSKVYVSANSGLAG
ATDLGSSKIESAGSSQAFKSSSTLVVEGGVIEAAMNACTHDLKAKMEREG
VKDAVFNLRNTGTHSWPGWYDDINSSWPIFAQAFNLPKDPSAPEAATYAA
EEGTSANEMNAEADTQDAKLDEAEANTEAPADSLPVDTEATGH
cora7-c3pk62: Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) (Corynebacterium nigricans)Trehalose corynomycolyl transferase C, 1 reference(s)Corynebacterium aurimucosum Show
MPNTASTQPRRSAKDSGLRSPSAARKGLTIAALPTAVAVGFALLPIANAQ
SSSSSTEGITDLLGSSNLSDSFAPSNPPQRTPVETEYPKIEGLPEGVSVS
RVEYLTNRHLKVYIKSAAMPDKEQVVQIQLARDWYSSPDKKFPEVWALDG
LRARDDESGWTIETNILSQYADRNVNLIMPVGGESSFYSDWQKEDNGTHY
MWETFLMRELIPVLEKGYRSNGNRAVTGISMGGTAAMNLAERNPWAFKYV
GSFSGYLDTTTTGMPEAITAAQADAGGFTSTNMWGDLYSQDWIDHDPKLG
IENLKDMKVYVSAGNGKDDYGQIGSVAKGQANLAGVGLEAISRMSTQTFV
DYAKRAGVEPVVKFRPTGVHSWEYWQFEMTEAWPYIAD
cora7-c3pk63: Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) (Corynebacterium nigricans)Trehalose corynomycolyl transferase B, 1 reference(s)Corynebacterium aurimucosum Show
MSSLSSGLRTRVLSVVAAIAVALGLVVTAGTQEASAANRDWLRGDATGAC
EWDRVGYWVQRCDVWSQAMGRNIPVQIQPAKNGGNAGLYLLDGLRATEST
NAWINDVNAARTYVDHNITLVMPVGGAGSFYADWNGPATYDLVKPVNYQW
ETFLTQELPAYLEGNFGVARNNNSIAGLSMGATAAITLAGKHPEQFRQAL
SYSGYLTTTLPGAQTFMRLALLDAGGFNINAMYGSIINPKRFSNDPFNLI
PDLAANGTDVYVSAASGIPGPVDQQRYRPEHIAAGVALEGFANATTRLWE
LKARAMGVRLQTDYPGQGLHNWEQFGYQLERSKPQVLNVMNAW
coram-SLPA: Corynebacterium ammoniagenes (Brevibacterium ammoniagenes) surface layer protein a, 1 reference(s)Corynebacterium ammoniagenes Show
MKRMKSLAAALTVAGAMLAAPVATAAEKTPADIAGDTALSEIQELEVDST
IEGQKWYQKYADDERVLKLQATSPAMDGRKVPLAIIRAQNPDRPTIYLLN
GAGSAEQDTDWLNQSEAVDFYADKDVNVVIPQAGAFSYYTDWNTTPNKSY
LKGPQKWETFLTKELPGPLEERLQSNNKRAIAGMSMSATSSLLLAQHNQG
FYDAVGSYAGCAGTSTPFEYEAMRLTVNRGGGEPEQMWGKMGSRTNRYND
ALLNSDKLRGTALYISSGNGLPGETDMPSYYTKQGVDPTTASVGAATLQI
EGGIIEAGVNHCTHNLEAKLKSQNIPAIYNFRDTGTHSWPGWREDLEKSW
PVFEKALF
cordi-q6ned6: Corynebacterium diphtheriae putative major secreted protein, 1 reference(s)Corynebacterium diphtheriae Show
MRFPSISSSVRRACATATAVIALAGVAAPSANAQSSNPIEAGSSALNYGA
NSLLAEWSKNPHLGEDINSFYRGMHMYSPWAQFPLWNMWGSPTPYPIEAE
RDFAAPRLVKVEKDERFDVDRLFIESPAMRRIVQVQVQHPKDRTTPAPML
YLLDGVTAPSQSGWLRKGDVQGAMANEHVTVIMPTEAGGTNYTDWNETDP
YLGRAKWETFLIKELPGVLVQPETKIAYNGKSYIGGLSMGGSAAVRLANL
YPEKFVGTFGVSGCYSPVNTSGRELFNLAARVIGGNPDLMWGRDITEQRR
RNDVVANPSGIASMDTYIYVANGVATPSDVNGPKEDGPFTLFGNIVLEKM
SYRCTQELEASVREKIADPSRITFDYHDGGVHSWPYYRQQLPVAWANVSK
GQYTYR
cordi-q6nes3: Corynebacterium diphtheriae putative secreted antigen, 1 reference(s)Corynebacterium diphtheriae Show
MTIVSRLKQASTKAVATVASLATVVAILVSGAGTATAANRDFLRGDATGT
CEWDGVAHWVQRCDVFSPAMGRNITVQIQPAQRGGNAALYLLDGARANEI
ANAWTTDAHVQDLFVDHNITLVMPVGGAGSFYTDWVGPAGPQNAIYRWET
FLTQELPGYLAANFGVSPTNNSIAGLSMGATAAMNLAALHPDQFRQVLSY
SGYLSMSVPGTYLMMTLALQEVGGFNINNMYGSFFGLRRFQLDPLVNAAG
LAGKDVYVSAASGIWGGPDYSYAVNDRINGSILEIASRVSTRIWEAQARA
IGLNLTTNYPLLGVHNWVQWRYQIEQSKPRILDVMNAW
cordi-q6nes4: Corynebacterium diphtheriae putative secreted antigen, 1 reference(s)Corynebacterium diphtheriae Show
MRDTAFRKRGSLWIATAAVPVALAMGASVMVPANAQSSGSSGLLGGQTDY
LNQQGVKRTPVRTDHPKVDGLPAGVSVDRVEWLGGRRVAVYVNTPSMGQV
QVQILLARDWFQDPNRSFPSVWALDGLRATDVENGWTIGTNIEQFYSDKN
VNVILPVGGQSSFYSDWQQPNNGKHYKWETFLTNELVPVLKNGFRTNDDR
AVVGLSMGGTAAINLAERRPDLFKFVGSFSGYLDTTSIGMPAAIRAAQKD
AGGYDSTAMWGPDGSQDWIDHDPKLGVEALRGITTYVSAGSGRDDFGEPG
SVANKKGSYAGIGLEVISRMTTETFVAHARRAGVEVQAFFRPSGVHDWPY
WQFEMTQAWPYMANAL
cordi-q6njn3: Corynebacterium diphtheriae surface layer protein a, 1 reference(s)Corynebacterium diphtheriae Show
MKFRRSLAALSIAATSVVGTMVAPAQAANLNPDTVRGQVAPATVYEGATP
GLNPAWREKATGDRVVEMWAHSPSMNRNVPLVVLKAANPGRPTIYLLNGG
DGGEGSANWVMQTKALDFYRDKDVNVVIPMAGKFSYYTDWVSEAPSLGGK
QNWETFLTKELPGPIERHLGASNKRAIAGLSMSATSALVLAEHAQGFYDA
AGSFSGCAATSSPLTYHFLRLTLERGGATPEQMWGPQGSEVNRYNDALIN
AERLRGTEVYVSNNSGAVGKYDLPSSPRLAGKDPVTIFATNLITATEGGI
IEAGTNMCTHDLKVKMDSLNIPATFNFRNTGTHSWGYWEEDMVASWELFN
MAFNK
coref-CE0356: Corynebacterium efficiens (and strain YS-314) conserved hypothetical protein, 1 reference(s)Corynebacterium efficiens Show
MGAIHHNFTRERLMKLLRRIAAPVAALGIALSTVVAPTAVSAAELTPAAV
AGDTPQSTITVGAKYPEQPAPRWRARVNASGERVKEMWAYSPSMDRDVPL
VVITADESAGPRPVIYLLNGGDGGEGNANWIMQTDVIDFYLEKNVNVVIP
MEGKFSYYTDWVQENAALGGKQMWETFLVKELPGPLEEELNADGQRAIAG
MSMSATTSLLFPQHYPGFYDAAASFSGCASTSQPLPWEYIRLTLDRGNAT
PEQMWGPRGGEVNIYNDALINSDKLRGTDLYISNASGLAGHWESANSPRF
NGLDQAYLSLAMTETIVTGGLIEAATNKCTHDLKAKLDHAGIPADWNLRP
TGTHSWGWWQDDLRGSWDTFARSFGLENENA
coref-CE0984: Corynebacterium efficiens (and strain YS-314) putative surface layer protein, 1 reference(s)Corynebacterium efficiens Show
ERIRQINAYSPSMERWIPLVWIVPEDTSEPRPTLYALGGGDGGQGSANWI
TKTDMPELMSSNNVHVIMPMLGSHSFYADWVEENDSLGGKQQWETFLTHE
LPEPLEAAIGGDGQRSIIGMSMSGGSVVNIASHQPNFYSSVASLSGCAET
NSWMGRRGVAATVYSGNATPTQIFGEVDSDYARYNDPVINAHRLAKQDNL
YVFAASGVWSEVDVEGENAPEDEKGLKNRITVGFRIEALSNTCTHNLKAA
TDYHGIDTIHYDFRPTGTHAWDYWNEALHRFFPLMMQGFGL
coref-CE1488: Corynebacterium efficiens putative (and strain YS-314) ps1 protein, 1 reference(s)Corynebacterium efficiens Show
MRKSVSRALVAGVITLSLTTPAAVAQSSGSFSSSGSSAQDFIAFSSGNPD
VSGSSLDGLLSSMSLLGSSQAPLPGALTSSDDAYPFPTDPTIGEAEIVDK
QPMDGLRLERWTVASPSMQRNVDVQIMRSVDAGAPAPMLYMLDGIGGNRN
SSGWINHGQGPKVFGDENVTVVMPLGAAASMYSDWVEEDPALGRIMWETF
IVEELAPLLEAEEELNFNGHRGIGGLSMGATGAVHLANANPDFFDAVIGI
SGCYSTLDPIGQATVSLIVKSRGGDVENMWGPVGSRTWQEHDVVSNPEGL
RNMAVYLSAANGVVDEIDREEYADEPFYNLLAGTVLERGALSCTEALDDA
MQDAGMTHQVVDYKGAGAHNWRNFNEQLQPGWDAVKDALY
coref-CE2710: Corynebacterium efficiens (and strain YS-314) putative ps1 protein, 1 reference(s)Corynebacterium efficiens Show
MTGPQAVSGFHIYFCRRRNMSVFSRAGAVSHKLLALLVALATAAGLMVVG
TGTAQAANRDWLRPDSTGHCDWDGVGYWVQRCDVYSPAMGRNIAVQIQPA
QRGGNAGLYLLDGMRATTWSNAWLVDTNAAALYAPHNITLVMPVGGAGSF
YADWNHPATLSSAEPVVYMWETFLTAELPAYLEQHFGVARNNNSVAGLSM
GGTAALNLAAKHPGQFRQAMSYSGYLTTTAPGMQTMLRLAMLDTGGFNVN
AMYGSVINPRRFENDPFWNMGGLRGKDVYVSAASGLWGPQDNGTRVDHRI
NGSVLEAVSLATTRAWEAKARAEGLNVTADYPNTGIHSWAQFSSQLHKTR
DRVLNVMNAW
coref-CSPA: Corynebacterium efficiens (and strain YS-314) ps1 protein, 1 reference(s)Corynebacterium efficiens Show
MMASTENNEKDNFMRDTASRSKKSRRRSLWIAAGAVPTAIALSLSLASPA
AVAQSSFGSSDIIDSGVLDSITRGLTDYLTPRDEALPAGEVTYPAIEGLP
AGVRVNSAEYVTSHHVVLSIQSAAMPERPIKVQLLLPRDWYSSPDRDFPE
IWALDGLRAIEKQSGWTIETNIEQFFADKNAIVVLPVGGESSFYTDWNEP
NNGKNYQWETFLTEELAPILDKGFRSNGERAITGISMGGTAAVNIATHNP
EMFNFVGS