Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: ABHD10

ABHD10


Genes:Proteins in ABHD10 (151)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9ceta-a0a341amk9: Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise). mycophenolic acid acyl-glucuronide esterase, mitochondrial isoform X1Neophocaena asiaeorientalis asiaeorientalis Show
MARVGLTSWVPCRRWGWMAVSFGFHRGLSTLLAPKAERAPRWLPACRQKT
SISFLSRPDLPNLAYKRLKGKSPGIIFIPGYMSNMNGTKALAIEEFCKSL
GHAYIRFDYSGVGNSDGNLEECTVGKWRKDVLSIIDDLAEGPQILVGSSL
GGWLMLHAAIARPQKVVALIGVATAVDSLVTQFNQLPVEAKKEIEMKGVW
SMPSKYSEEGFYRIQYSVIKEAEHYCLLHSPIPVNCPIRLLHGMKDDIVP
WHTSMQVADRVVSTDVDVILRKNSDHRMKEKADIQLLVYTIDDLIDKLST
VVK
9cich-a0a3b4f2h8: Pundamilia nyererei. Abhydrolase domain containing 10Pundamilia nyererei Show
MAAVALRSCRRGLSQILSNGGLAALSSKRLEEPRRHKSSVQYASRPDLPK
LAYRRVKGKSPGVVFLPGYGSNMNGQKAEALEEFCKSLGHSYLRFDYTGH
GASGGVLSEGTIGTWKKDVLFVLDELAEGPQILVGSSIGGWLMLLAAIAR
PEKTAALVGISTAADHVVTAFNSLPLETRKEFEAKGEWTIPTKHMEEGVY
KFNMDFLREAENHCVLQSPIPITCPVRLIHGLKDEDVPWHISMQVAERVL
SSDVDVILRRHGQHRMSDKDDIKLMVYTIDDLIDKLTTMV
9cich-a0a3p9d5c0: Maylandia zebra (zebra mbuna). Abhydrolase domain containing 10, 1 reference(s)Maylandia zebra Show
MAAVALRSCRRGLSQILSNGGLAALSSKRLEEPRRHKSSVQYASRPDLPK
LAYRRVKGKSPGVVFLPGYGSNMNGQKAEALEEFCRSLGHSYLRFDYTGH
GASGGVLSEGTIGTWKKDVLFVLDELAEGPQILVGSSIGGWLMLLAAIAR
PEKTAALVGISTAADHVVTAFNSLPLETRKEFEAKGEWTIPTKHMEEGVY
KFNMDFLREAENHCVLQSPIPITCPVRLIHGLKDEDVPWHISMQVAERVL
SSDVDVILRRHGQHRMSDKDDIKLMVYTIDDLIDKLTTMV
9cnid-a0a3m6tea2: Pocillopora damicornis. Uncharacterized protein, 1 reference(s)Pocillopora damicornis Show
MRHLFKSPCTQNRTIRHLLKKMSSFAESTVQYAFPSPGERVAFRQSPGKS
PGVIFLPGLMSTMEGTKALALERYCKKIGHSYVRFDYRGYGMSSGESQEC
TIGMRKEDVLTILDGVAKGPQILVGSSLGGWISLLVAMSKPDQIRGLIGI
ASAVDFVSRRFDTLSHEEKREVEATGKWILPSQHTEEPYVLDSIVIEEAR
QHVLQEKELYPICCPVRLLHGMKDGDVPYQVSLDLVNQLESDDVQLTLIK
DGGHRLSDAHNLQLLTTTLGHLIDQVKQSD
9gobi-a0a3b4biy6: Periophthalmus magnuspinnatus. Abhydrolase domain containing 10, 1 reference(s)Periophthalmus magnuspinnatus Show
MLVSGDNFKHLFGLLQRHLLLDRRHKSTVQYASRPDLPKLAYRRVKGKTP
GVVFLPGYGSNMNGQKGEALEEFCRSLGHSCLRFDYTGHGASEGVLAEGT
IGTWKKDVLFILDELVEGPQILVGSSIGGWLMLLAAIARPEKIAALVGIS
TAADHIVTSFNSLPLETRKEFEEKGEWVVPTKHSEEGFYKFNMDFLREAE
NHCVLQSPIPITCPVRLIHGLKDEDVPWHISMQVAERILSPDVDVILRRH
GQHRMSDKDDIKLMVYTIDDLIDKLTTMV
9pase-a0a218ujv2: Lonchura striata domestica (Bengalese finch). Mycophenolic acid acyl-glucuronide esterase, mitochondrialLonchura striata domestica Show
MAAMAAMALLRPGRAALRPALSPLRVCRLKSSVSFLTRPDRPNIAYQKLK
GRNPGVIFLPGFNSNMNGQKATALEDFCKSLGHAFIRFDYTGCGSSHGKF
EECTIGKWRKDVLSILDELTDGPQFLVGSSMGGWLMLHAAIARPDKVAAL
VGVAVAADHVVTTFKRLPIEAQKEIEQKGEWKYQTKHNEEGYYSLTYDFI
REAENHCVLNSPIPVTCPIRLIHGMRDGDVPWEISMQVADRVLSKDVDVI
LRKIGQHRMSDKEDTKLLVNTVDDLIDKLSTVA
9tele-a0a0p7xhe1: Scleropages formosus (Asian bonytongue). Mycophenolic acid acyl-glucuronide esterase, mitochondrial-likeScleropages formosus Show
MRWTDAFRRSPAAEAFLQSWDVRFFLTGFPHHRVSFPGARHKSSIQYATR
PDLPKLAYQKVKGKSPGVVFLPGFASTMAGRKAEALEEFCKSLGHSYLRF
DYTGCGASEGQWAEATVGTWKKDVLFVLDELVEGPQILVGSSMGGWLMLL
AALARPEKTAALVGIATAADYFVTAFKSLPLEVRKEMEEKGEWTLPTKYN
EEGVYRISMDFLKEAENHCVLQGPIPVTCPMRLIHGLKDQDVSWHISMQV
AERVLSTDVDVILRKHGQHRMSEKEDIKLMVYTIDDLIDKLTTLV
9tele-a0a0s7hi29: Poeciliopsis prolifica (blackstripe livebearer). ABHDAPoeciliopsis prolifica Show
KLAYRRVKGKSPGVVFLPGYGSNMNGQKAEALEEFCRSLGHSYLRFDYTG
HGASEGALPDGTVGIWKKDVLYVLDELTEGPQILVGSSLGGWLMLLAAIA
RPEKTAALVGIASAADHFVTAFNSLPLETRKELEEKGEWSLPSKHTEEGF
YKFSMDFLREAENHCVLQSPIPITCPVRLIHGLKDEDVPWHVSMQVAERV
LSPDVDIILRRNGQHRMSEKDDIKLIVYTIDDLIDKLTTLV
9tele-a0a1a7wf21: Iconisemion striatum. Abhydrolase domain containing 10bIconisemion striatum Show
MAAVSLRSCRRGLSQFLRNGGVAASHSARLQGDIRHKSSVQFASRPDLPK
LAYRRVKGKSPGVIFLPGYGSHMNGQKAEALEEFCRSLGHSCLRFDYTGH
GASEGVLAEGTIGTWKKDVLFVLDELTEGPQILVGSSMGGWLMLLAAIAR
PEKTAALVGISTAADHFVTAYNSLSLETRKEFEAKGEWTLPSKHSEEGFY
KFNLDFLREAENHCVLQSPIPITCPVRLLHGLKDEDVPWHISMQVAERVL
SADVDIILRRNGQHRMCEKDDIKLMVYTIDDLIDKLTTSV
9tele-a0a2i4aqg1: Austrofundulus limnaeus. mycophenolic acid acyl-glucuronide esterase, mitochondrialAustrofundulus limnaeus Show
MAALSLRSCRKGISQFLSNGGVAALSSSRLQGDRRHKSSVQYASRPDLPK
LAYRRVKGKSPGVVYLPGYASNMNGQKAESLEEFCRSLGHSYLRFDYTGH
GASEGVLAEGTIGTWKKDVLFMLDEFTEGQQILVGSSMGGWLMLLAAIAR
PEKTAALVGISSATDHFVTAFKSLPIETRKELEEKGEWTLPSKHSEEGFY
KFSMDFLREAENHCVLQSPIPITCPVRLIHGLKDEDVPWHISMQVAERVL
SPDVDIILRRNGQHRMSEKDDIKLMVYTIDDLIDKLTTMV
9tele-a0a3b3sv81: Paramormyrops kingsleyae. Abhydrolase domain containing 10, 1 reference(s)Paramormyrops kingsleyae Show
MAALVVRWRGWSAVRRKVALFLAQSSGGIRCKSSIQYVSRPDLPKLAYQK
VKGKSPGVVFLPGFASTMAGQKAEALQEFCRSLGHSYLRFDYTGCGTSES
QWTECTLGTWKKDVLFVLDELVEGPQILVGSSLGGWLMLLAAIARPEKVA
ALVGIGTAVDHFVTAFKALPLEVKKEAEEKGEWTLATKYNEEGVYRISMD
FIREAENHCILQGPIPVTCPVRLLHGLKDQDVPWHVSMQVAERVLSTDVD
VILRKEGQHRLSEKEDIKLIVYTIDDLIDKLTTLV
9tele-a0a3b4z349: Stegastes partitus (bicolor damselfish). Uncharacterized proteinStegastes partitus Show
MAAVALRSCRRGLSQILSNGGFAALSTKRLEGDRRHKSTVQYASRPDLPK
LAYRRVKGKSPGVVFLPGYGSNMNGQKAEALEEFCRSLGHSYLRFDYTGH
GASEGVLAEGTIGTWKKDVLYVLDELAEGPQILVGSSIGGWLMLLAAIAR
PEKTAALVGISTAADHLVTAFNTLPLEIRKEFEEKGEWTVPTKHSEEGLY
KFNMDFLREAENHCVLQSPIPITCPVRLIHGLKDEDVPWHISMQVAERVL
SPDVDVILRRHGQHRMSEKDDIKLMVYTIDDLIDKLTTLV
ailme-g1mik5: Ailuropoda melanoleuca (Giant panda). Abhydrolase domain containing 10, 1 reference(s)Ailuropoda melanoleuca Show
TAGVGMAALGAWVPCRRWSKAAVFGLHSGLTALLARKAEGTPRWLPACRQ
KTSVSFLSRPDLPNLAYKKLKGKSPGVIFIPGYISNMNGTKALAIEEFCK
SLGYAYIRFDYSGIGNSAGNLEECTVGRWRKDVLSIIDDLAEGPQILVGS
SLGGWLMFHAAIARPQKVVALIGIATAVDGLVTQFNQLPIEVKKEVEMKG
VWAMPSRYSEEGVYHIQYSFIKEAEHHCLLHSPIPVKCPVRLLHGMKDDI
IPWHTSIQVADRVLSTDVDVILRKHSDHRMKEKADIQLLVYTIDDLIDKL
STVVN
allmi-a0a151mdb6: Alligator mississippiensis (American alligator). Abhydrolase domain containing 10, 1 reference(s)Alligator mississippiensis Show
MAAAAARALWRGSVRWCPGAGDGLWAVPVCRQKSSVSFLTRPDRPNLAYH
KLKGKNPGVVFLPGLNSNMNGHKAIALEEFCKSLGHAYVRFDYTGCGSSD
GNLKECTIGKWRKDVLSVLDELTEGPQILVGSSLGGWLMLHAAIARPEKV
AALVGVAVAADYVITTFNQLPVEVKKVVEEKGEWKLPTKHNEEGFYCLTY
DFIKEAENHCLLASPIPITCPVRLIHGMKDEDVPWHISMQVADRVLSKDV
DIILRKAGQHRMKEKDDTKLLVYTVDDLIDKLSHSI
allsi-a0a3q0hdl7: Alligator sinensis (Chinese alligator). mycophenolic acid acyl-glucuronide esterase, mitochondrialAlligator sinensis Show
MAVARALWRGAVCWCPGAGDGSWAVPVCRLKSSVSFLTRPDRPNLAYHKL
KGKNPGVVFLPGLNSNMNGHKAIALEEFCKSLGHAYVRFDYTGCGSSDGH
LKECTIGKWRKDVLSVLDELTEGPQILVGSSLGGWLMLHAAIARPEKVAA
LVGVAVAADYVITTFNQLPVEVKKVVEEKGEWKLPTKHNEEGFYCLTYDF
IKEAENHCLLASPIPITCPVRLIHGMKDEDVPWHISMQVADHVLSKDVDI
ILRKAGQHRMKEKDDTKLLVYTVDDLIDKLSHLV
amaae-a0a0q3pme8: Amazona aestiva (Blue-fronted Amazon parrot). Mycophenolic acid acyl-glucuronide esteraseAmazona aestiva Show
MMPKLCLSAWQLRSHWCLDRVRRLKSSISFLTRPDQPNLAYHKLKGRNPG
VIFLPGFNSNMNGQKATALEDFCNSLGHAFVRFDYTGCGSSDGKFEECTF
GKWRKDVLCILDELTDGPQILVGSSMGGWLMLHAAIARPDKVAALVGVAA
AADYLVTTFKKLPIETQNEIEEKGEWRFPTRYNEEGYYSLKYDVIREAEN
HCLLNSPIPVTCPIRLIHGMKDSDVPWQISMQVADRVLSKDVDVILRKTG
QHRMSEKEDIKLLVNTVDDLIDKLATFS
amppe-a0a3p8tr77: Amphiprion percula (Orange clownfish) (Lutjanus percula).Abhydrolase domain containing 10Amphiprion percula Show
MAAVALRSCRRGLSQILSNGGFAALSTKRLEGDRRHKSTVQYASRPELPK
LAYRRVKGKSPGVVFLPGYGSNMNGQKAEALEEFCRSLGHSYLRFDYTGH
GASEGVLAEGTIGTWKKDVLFVLDELAEGPQILVGSSIGGWLMLLAAIAR
PEKTAALVGISTAADHLVTAFNSLSLETRKELEEKGEWTVPTKHSEEGFY
KFSMDFLREAENHCVLQSPIPVTCPVRLIHGLKDEDVPWHISMQVAERVL
SPDVDVILRRHGQHRMSEKDDIKLMVYTIDDLIDKLTTLV
anaga-a0a3n0xym7: Anabarilius grahami (Kanglang fish) (Barilius grahami). Acyl-coenzyme A thioesterase 9, mitochondrialAnabarilius grahami Show
MLYLDGKRHFGVRQKSTVQYISRPDQPKLAYRRVKGKSPGVVFLPGYGSN
MSGQKAEAMEEFCRSLGHGYLRFDYSGHGASEGVFSEGTIGTWKKDVLFM
LDELAEGPQILVGSSMGGWLMLLAAIARPEKTKALVGISTAADHFVTAFK
TLPIEVRKECEDKGSWTVPTKSNEEGVYTVSMDFLREAENHCILQSPIPI
TCPVRLIHGLKDEDVPWHISMQVAERILSPDVDIILRRHGQHRMAEKDDI
KLIVYTIDDLIDKLTTMV
anaga-a0a3n0ye42: Anabarilius grahami (Kanglang fish) (Barilius grahami). Mycophenolic acid acyl-glucuronide esterase, mitochondrialAnabarilius grahami Show
MASTVLRNCSKVLKINVGQFTILPHVSTGVRHKTTIQYATRPDLPKLAYR
KMKGKSPGVVFLPGFASHMGGQKAEALEEFCKSLGHSYLRFDYSGCGSSE
GEMGNYNIGAWKKDVLYVLDELVEGPQILVGSSMGGWLMLLAALARPEKT
AALVGISTAADHFVTAFHALPIETKKEIEEQGFWKFPTKHNEEGFYTLSL
DFLKEAENHCILHSPMPVSCPVRLIHGLKDSDVPWHVSMQVAERVLSNDV
DVIFRKLGLHRMSEKDDIKLIVYTIDDLIDKLTTLG
anapl-u3i5h5: Anas platyrhynchos (Mallard) (Anas boschas). Abhydrolase domain containing 10, 1 reference(s)Anas platyrhynchos Show
MFLLVCRQKSSVSFLTRPDRPNLAYHRLKGRNPGVIFLPGFNSNMNGQKA
TALEDFCSSLGHAFVRFDYTGCGSSDGNFEECTIGKWKKDVLSILDELTD
GPQILVGSSLGGWLMLHAAIARPNKVAALVGVAVAADHLVTTFKRLPIEA
QKEIEEKGEWKFPTKYNEEGYYSVTYDFIQEAENHCLLNSPIPILCPVRL
IHGMKDSDVPWQISMQLADRILSKDVDVILRKTGQHRMSEKDDTKLLVNT
VDDLIDKLSTLV
anoca-g1kqp8: Anolis carolinensis (Green anole) (American chameleon). Abhydrolase domain containing 10Anolis carolinensis Show
KSKRSIFFCVGCRQKSSPSFLNRADLPKLAYHKLKGKNPGVVFLPGLFSN
MNGEKALALEEYCKSVGHAFVRFDYRGCGGSDGNTKENTLGKWRKDVLSI
LDELTQGPQILVGSSLGGWLMLHAAIARPEKVAALVGVAVAADHLVATFQ
QLSVEVKKEIEEKGEWRMPTKHNEEGFYSVPYELIQEAENHCVLNSPLPI
KCPVRLIHGLKDDDVPWQISMKIAECVVSGDVDIILRKGGGHRMKEKEDI
KLIVYTVEDLIEQLST
aotna-a0a2k5ei86: Aotus nancymaae (Ma's night monkey). Abhydrolase domain containing 10Aotus nancymaae Show
MAVARKAAVAAWVPCRSWGWAAVPFGPYCGLNTLLAPMPQRAPRWLPACR
QKTSLSFLNRPDLPKLAYKRLKGKSPGIIFIPGYISNMNGTKALAIEEFC
KSLGHAYIRFDYSGVGSSDGNLEESTVGKWRKDVLSIIDDLAEGPQILVG
SSLGGWLMLHAAIARPEKVMALIGVATAADSLVTQFNQLPVEVKKEVEMK
GVWSMPSKYHEEGVYHIQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDD
VVPWHTSMQVADRVLSTDVDVILRKHSDHRMKEKADIQLLVYTIDDLIDK
LSTIVN
aptfo-a0a087qt38: Aptenodytes forsteri (Emperor penguin). Uncharacterized proteinAptenodytes forsteri Show
VCRLKSSVSFLTRPDRPSLAYHKLKGRNPGVIFLPGFNSNMNGQKATALE
DFCNSLGHAFVRFDYTGCGSSDGNFKECTIGKWRKDVLSILDELTDGPQI
LVGSSMGGWLMLHAAIARPDKVAALVGVAVAADHLVTTFKKLPIEAQKEI
EEKGEWKFPTKHNEEGYYSLTYDFIREAENHCVLNSPIPITCPIRLIHGM
KDGDVPWQISMQVADRVLSKDVDVILRKIGQHRMSEKEDTKLLVNTVDDL
IDKLATL
astca-a0a3p8r9z3: Astatotilapia calliptera (Eastern happy) (Chromis callipterus).Abhydrolase domain containing 10Astatotilapia calliptera Show
MLVSGDNFKHLFGLLQRHFLSVPGVEPRRHKSSVQYASRPDLPKLAYRRV
KGKSPGVVFLPGYGSNMNGQKAEALEEFCRSLGHSYLRFDYTGHGASGGV
LSEGTIGTWKKDVLFVLDELAEGPQILVGSSIGGWLMLLAAIARPEKTAA
LVGISTAADHVVTAFNSLPLETRKEFEAKGEWTIATKHMEEGVYKFNMDF
LREAENHCVLQSPIPITCPVRLIHGLKDEDVPWHISMQVAERVLSSDVDV
ILRRHGQHRMSDKDDIKLMVYTIDDLIDKLTTMV
astmx-a0a3b1it79: Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus).Abhydrolase domain containing 10, 1 reference(s)Astyanax mexicanus Show
MAAVAALTHWRRGVFQTVSNGALGLLSPAFLQGVRQKSSVQYASRPNLPK
LAYQRVKGKSPGVVFLPGYGLNMSGQKAEALQDFCKSLGHSYLRFDYTGH
GASEGTFSEGTIGTWKKDVLFILDEVAEGPQILVGSGMGGWLMLLAAIAR
PEKTKALVGISTAADHFVTAFKSLPLEARKEFEDSGMWTIPTKSNDEGIY
TVSMDFLKEAENHCILQSPIPITCPVRLIHGLKDEDVPWHISMQVAERVL
STDVDIILRRHGQHRMAEKDDIKLMVYTIDDLIDKLTTMV
balas-a0a384a444: Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni). mycophenolic acid acyl-glucuronide esterase, mitochondrial isoform X1Balaenoptera acutorostrata scammoni Show
MARVGLGAWVPCRRLGRMAVSFGFHRGLSTLLAPKAERAPRWLPACRQKT
SISFLSRPDLPNLAYKRLKGKSPGIIFIPGYISNMNGTKALAIEEFCKSL
GHAYIRFDYSGVGNSDGNLEECTVGKWRKDVLSIIDDLAEGPQILVGSSL
GGWLMLHAAIARPQKVVALIGIVTAVDGLVTQFNQLPVEAKKEIEMKGVW
SMPSKYSEEGVYHIQYSVIKEAEHHCLLHSPIPVNCPIRLLHGMKDDIVP
WHTSMQVAARVVSTDVDVILRKNSDHRMKEKADIQLLVYTIDDLIDKLST
VVN
bovin-ABHDA: Bos taurus (Bovine); Bos mutus (wild yak) abhydrolase domain containing 10, 3 reference(s)Bos taurus Show
MAGVGLAAVPAWVPCRRWGLAAVTFGFHHGLSTLLARKTERAPQWLRACR
HKTSISFLSRPDLPNLAYKRLKGKSPGIIFIPGYISNMNGTKALAIEEFC
KSLGHAYIRFDYSGVGNSDGNLEECTVGKWRKDVLSIIDDLAEGPQILVG
SSLGGWLMFHAAIARPQKVVALVGVATAVDGLVTQFNQLPIETKKEIEMK
GVWPMPSKYSEEGVYRIQYSVIKEAEHHCLLHSPIPVKCPVRLLHGMKDD
IVPWHTSVQVADRVVSTDVDVILRKNSDHRMKEKADIQLLVYTIDDLIDK
LSTIVH
brafl-c3zj72: Branchiostoma floridae (Florida lancelet) (Amphioxus). Uncharacterized protein, 1 reference(s)Branchiostoma floridae Show
MARAAGNKISLLRFSSLPGVQYLVRGHDPDLAYCSTPGRSPGVIFFPGFL
SNMDGTKALALEGYCRAAGLAYTRFDYRGMGLSQGSIENCSIATWRQDCL
DVLDRLTTGKQIIVGSSMGGWLMLLIAMNRPERLHGLVGISTAADFVKKH
WEQAPIIVQNQWREKGVYTFPSDYTDSGTVSLGYGWIQDSLPYCILGTRM
PITCPVRLIHGLGDQDVPYQTSAQILEELDAKDVDLILRKSGGHRMSEPE
DLELIIDTVDKLVNTLGEGGTGQEPDNVQGAQSVQEEHGRITEPDSRQG
calja-u3cmb7: Callithrix jacchus (White-tufted-ear marmoset). Alpha/beta hydrolase domain-containing protein 10, mitochondrial isoform 1, 1 reference(s)Callithrix jacchus Show
MAVARTAAVAAWVPCRSWGWAAVAFGPHRGLNTLLAPMPRRAPRWLPACR
QKTSLSFLNRPDLPKLAYKRLKGKSPGIIFIPGYISNMNGTKALAIEEFC
KSLGHAYIRFDYSGVGSSDGNLEESTVGKWRKDVLSIIDDLAEGPQILVG
SSLGGWLMLHAAIARPEKVMALIGVAAAADGLVTRFNQLPVEVKKEVETK
GVWSMPSKYHEEGVYHIQYSFIKEAEHHCLLHSPIPVSCPVRLLHGMKDD
VVPWHTSMQVADRVLSTDVDVILRKHSDHRMKEKADIQLLVYTIDDLIDK
LSTIVN
calmi-k4fsh3: Callorhinchus milii (Ghost shark). Abhydrolase domain-containing protein 10, mitochondrial, 1 reference(s)Callorhinchus milii Show
MACVQFLTRQGLPPLAYFRSCGQNPGVVFLTGFRSNMNGMKALALEEYCR
SEGRSFVRFDYTGCGSSKGDADSCFLGNWKNDVLSVLDNLTTGPQVLVGS
SMGGWLMLLAGLARPEKIVGLVGIATATDHFVNAYKQLPLESRQEAERTG
QWTVASKYADSGFYTIKMDFVKEAEDHCLLQGTVPISCPVRLIHGMEDEL
VPWQNSVHLAERLASRDVDLLVRRSGDHRMTRDEDIQLLVAVVRDLVGKI
ERNGLKS
calmi-v9ki07: Callorhinchus milii (Ghost shark). Abhydrolase domain-containing 10, 1 reference(s)Callorhinchus milii Show
RPLMTALPGCQAPARCSLVMAAALRRLSLLPGERDTVWRLLWGRAVPQLV
GCRNKSSVQYLVRPDLPKLAYKRIKGKSPGIIFLPGFASTMNAEKALELE
DFSKSLGHSFIRFDYTGCGASEGVFSECTIGQWKKDVLAVIDELAEDPQI
LVGSSMGGWLMLLAAIVRPEKTAALVGIATGADYFVTAFNQLPLEMRKRI
EETGEWFMPTKQKESEFFKIPFQFLKEAENHCVLRSPIPITCPVRLIHGL
KDEDIPWQISLQVADNVLSADVDVILRKHGQHRMKGKDDLKLIVYTIDDL
IDKLTTLG
calsu-a0a226nc51: Callipepla squamata (Scaled quail). Uncharacterized proteinCallipepla squamata Show
ILLGFGFCVVVGSATTSDGCFFRFDYTGCGSSQGNLEECTIGMWRKDVLS
ILDELTDGPQILVGSSLGGWLMLHAAIARPDKVAALVGVAVAADHLVTSF
KRLPIEVQREIEEKGEWKFPTKHNEERYYTLTYDFIREAENHCVLNAPIP
ITCPIRLIHGMKDGDVPWQISLQVADRVLSKDVDVILRKAGQHRMSEKED
TKLLVNTVDDLIDKLAKLT
camfr-s9w5f6: Camelus ferus (Wild bactrian camel) (Camelus bactrianus ferus). Mycophenolic acid acyl-glucuronide esterase, mitochondrial, 1 reference(s)Camelus ferus Show
MCALRVVKIVQALFTKFRLPAGGACAASVPERCARFRRSARGERTAGKMA
GLGKAVVAAWEPYRRWGWAAVSFGVHRGLGALLARKPERAPRWLPGSRYP
SSRRFRQFCEGCEESSAGPWGILDKRGACRQKSSVSFLSRPDLPNLAYKR
LKGKSPGIIFIPGYISNMNGTKALAIEEFCKSLGHAYIRFDYSGIGNSDG
NLEECTVGKWRKDVLSVIDELAVGPQILVGSSLGGWLMLHAAIARPQKVV
ALIGIAAAVDSLVTQFNQLPIETKKEIEMKGVWSMPSKYSEEGVYRVQYS
VVKEAEHHCLLHSPIPVSCPVRLLHGMKDDIIPWQTSVQVADRIVSTDVD
VILRKHSNHRMKEKADLQLLVYTIDDLIDKLSTVVN
canlf-j9p8h1: Canis lupus familiaris (Dog) (Canis familiaris). Abhydrolase domain containing 10, 1 reference(s)Canis lupus familiaris Show
MAGLRLAALGARVPCRRWGGAAVCGFRRGLSAWLARKPEGTPRWPPACRQ
KSSVSFLSRPELPNLAYKKLKGKSPGVIFIPGYLSNMNGTKALAIEEFCK
SLGHACIRFDLSGVGKSDGNLQECTVGKWRKDVLSIIDDVAEGPQILVGT
SLGGWLMFHAAIARPQKVVALIGVATAVDGLVTQFNQLPVEVKKEIEMKG
MWDMPSKYSEEGIYHIQYSFIKEAEHHCLLHSPIPVNCPVRLLHGMKDDV
IPWHTSIQVADRVVSTDVDVILRKHSDHRMKEKADIQLLVYTIDDLIDKL
STIVN
cascn-a0a250xy53: Castor canadensis (American beaver). Mycophenolic acid acyl-glucuronide esterase, mitochondrial, 1 reference(s)Castor canadensis Show
MAGKGLSAVASWVPCRSWGWAAVPFSPQRSLLSLLAPKPPRAPFWLPACR
QKTSLSFLSRPDLPNLAYKSLKGKSPGIIFVPGYLSTMTGTKALAIEEFC
KSLGHAYIRFDYSGVGNSYGNLKECTVGKWRKDVLSIIDDIAVGPQILVG
SSLGGWLMLHAAIARPEKVVALIGIATATDGLVSQFHQLPVEVKKEVEMK
GVWTMPSKYHEEGFYHIQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDD
IVPWHTSMQLANQVLSTDVDVILRKNSDHRMKEKADIQLLLYTIDDLIDK
LSTMSLQK
cavpo-h0v5z0: Cavia porcellus (Guinea pig). Abhydrolase domain containing 10, 1 reference(s)Cavia porcellus Show
MASVGLAAWRSCFIGGQATASFGHYHNLSAPTLKSQRVPWRFPVCRQKTS
FSFLNRPDLPKLAYKRLNGKSPGVIFIPGYISNMNGTKALAIEEFCKSLG
HAYIRFDYSGVGNSEGNLEECTVGKWRKDILSIIDDIAVGPQILVGSSLG
GWLMLHAAIARPEKVMALVGVATAADTLVTRFNQLPVEVKKEAELKGTWT
LPSKYHEDGVHHIRYSFIQEAAHHCLLHSPIPVNCPVRLLHGLKDDVVPW
HTSMQVADRVLSTDVDVILRKDSDHRMKEKADLQLLTYTIDDLIDKLSTI
VN
cebca-a0a2k5rq06: Cebus capucinus imitator. Abhydrolase domain containing 10Cebus capucinus imitator Show
MAVARMATVAAWVPCRSWGWAAVPFGPHCGFNTLLAPMPQRAPRWLPACR
QKTSLSFLNRPDLPKLAYKRLKGKSPGIIFIPGYISNMNGTKALAIEEFC
KSLGHAYIRFDYSGVGSSDGNLEESTVGKWRKDVLSIIDDVAEGPQILVG
SSLGGWLMLHAAIARPEKVMALIGVATAADGFVTQFNQLPVEVKKEVEMK
GVWSIPSKYHEEGVFHIQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDD
VIPWHTSMQVADRVLSTDVDVILRKHSDHRMKEKADIQLLVYTIDDLIDK
LSTIVN
cerat-a0a2k5me28: Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). Abhydrolase domain containing 10Cercocebus atys Show
MAVARLAAVAAWVPYRSWGWAAAPVGPHRGLGALLALIPQRAPRWLPACR
QKTSLSFLNRPDLPNLAYKKLKGKSPGIIFIPGYLSYMNGTKALAIEEFC
KSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDLADGPQILVG
SSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMK
GVWSMPSKYSEEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDD
IVPWHTSMQVADRVLSTDVDVILRKHSDHQMKEKADIQLLVYTIDDLIDK
LSTIVN
cereh-a0a212c355: Cervus elaphus hippelaphus (European red deer). ABHD10, 1 reference(s)Cervus elaphus hippelaphus Show
MAGVGLASVAARVPCRRWGWAAVTFGFHHGLSTLLARKTERAPQWFRACR
HKTSISFLSRPDLPNLAYKRLKGKSPGIIFIPGYISNMNGTKALAIEEFC
KSLGHAYIRFDYSGVGNSDGNLEECTVGKWRKDVLSVLDDLAEGPQILVG
SSLGGWLMFHAAIARPQKVVALVGVATAVDGLVTQFNQLPIETKKEIEMK
GVWPMPSKYSEEGVYRIQYSVVKEAEHHCLLHSPIPVTCPVRLLHGMKDD
IVPWHTAVQVADRVVSTDVALKRYAP
chavo-a0a0a0aqh2: Charadrius vociferus (Killdeer) (Aegialitis vocifera); Manacus vitellinus (golden-collared manakin); Haliaeetus albicilla (White-tailed sea-eagle); Fulmarus glacialis (Northern fulmar); Calypte anna (Anna's hummingbird) (Archilochus anna); Tinamus guttatus (White-throated tinamou); Cariama cristata (Red-legged seriema); Tyto alba (Barn owl); Limosa lapponica baueri. Uncharacterized proteinCharadrius vociferus Show
VCRLKSAVSFLTRPDRPNLAYHRLKGRNPGVIFLPGFNSNMNGRKAAALE
DFCNSLGHAFIRFDYTGCGSSDGKFEECTIGKWRKDVLSILDELTDGPQI
LVGSSLGGWLMLHAAIARPDKVAALVGVAVAADHLVTTFKKLPIEAQKEI
EEKGEWKFPTKHNEEGYYSLTYDFIREAENHCVLNSPVPITCPIRLIHGM
KDDDVPWQISMQVADRVLSKDVDVILRKIGQHRMSEKEDTKLLVNTVDDL
IDKLSTL
chemy-m7bsp5: Chelonia mydas (Green sea-turtle) (Chelonia agassizi). Abhydrolase domain-containing protein 10Chelonia mydas Show
MTSFPIPWDQLLASQRTDHFGFAPIHQRPPFCSMQQRERLVQWMGSWPWV
LHPRCPRDFLYDLSSKLPSRTMASPLFLSRGALPRLAYTRLAGRSPGIVF
LLGFKDTRANPKCLALEQFCQESGRAFLSFDYTGCGSSDGCFEDCLIGHW
KNDVLTVLDELTSGPQILVGASMGGWLMLLAALERPGRVAGLVATGIGAD
AFITLYRELPPEVKSEMEQTGVFNYEMAGSGSVLIKREFFAEMKEHSLLG
RSSIPITCPVRLLHGMQDQLIPWGRAVQDQLIPWGRAVQVAEQLESQDVR
ITLFKAGQHGLKGAEELRVLVGTVRDLAESLQR
chemy-m7c0i8: Chelonia mydas (Green sea-turtle) (Chelonia agassizi). Abhydrolase domain-containing protein 10Chelonia mydas Show
MRGVRGRPRLAAAAVCGFDYTGCGSSDGNLQECTVGKWRKDVLSVLDELT
DGPQILVGSSLGGWLMLHAAIARPEKVAALVGVAVAADYLVTTFKQLPLE
VQKEIEEKGEWKLPTKHNEEGFYCLSYEFIKEAENHCLLSNPIPITCPIK
LIHGMKDEDVPWQVSMQIADHVVSTDVDVILRKVGQHRMSEKDDMKLLVY
TVDDLIDKLTTLA
chick-a0a1d5pj73: Gallus gallus (Chicken). Abhydrolase domain containing 10, 1 reference(s)Gallus gallus Show
MLLLSTFKSLHYSCRWKSSVSFLTRPDRPNLAYRKLKGRNPGVVFLPGLR
SNMNGQKATALEDFCSCLGHAYVRFDYTGCGSSQGNFEECTIGKWRKDVL
SILDELTDGPQILVGSSLGGWLMLHAAIARPDKVAALVGVAVAADHLVTA
FRRLPIEAQKEIEEKGEWKFPTKHNEEGYYSLTYDFIREAENHCLLNSPI
PVTCPIRLIHGMRDGDVPWQISMQVADRVLSKDVDVILRKAGQHRMSEKE
DTKLLVNTVDDLIDKLATLT
chlgu-a0a3l8sk00: Chloebia gouldiae (Gouldian finch) (Erythrura gouldiae). Uncharacterized protein, 1 reference(s)Chloebia gouldiae Show
MCHTPCLSELFSLLIALNWTVCRLKSSVSFLTRPDRPNIAYQKLKGRNPG
VIFLPGFNSNMNGQKATALEDFCKSLGHAFIRFDYTGCGSSHGKFEECTI
GKWRKDVLSILDELTDGPQILVGSSMGGWLMLHAAIARPDKVAALVGVAV
AADHVVTTFKRLPIEAQKEIEQKGEWKYQTKHNEEGYYSLTYDFIREAEN
HCVLNSPIPVTCPIRLIHGMRDGDVPWEISMQVADRVLSKDVDVILRKIG
QHRMSDKEDTKLLVNTVDDLIDKLSTVA
chlsb-a0a0d9r2l6: Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). Abhydrolase domain containing 10Chlorocebus sabaeus Show
MAVARLAAVAAWVPYRSWGWAAAPVGPHRGLGALLALIPQRAPRWLPAYR
QKTSLSFLNRPDLPNLAYKKLKGKSPGIVFIPGYLSYMNGTKALAIEEFC
KSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDLADGPQILVG
SSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMK
GVWSMPSKYSEEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDD
IVPWHTSMQVADRVLSTDVDVILRKHSDHRMKEKADIQLLVYTIDDLIDK
LSTIVN
colap-a0a2k5k737: Colobus angolensis palliatus (Peters' Angolan colobus). Abhydrolase domain containing 10Colobus angolensis palliatus Show
MAVARLAAVAAWVPYRSCGWAAAPVGPHRGLGALLALIPQRAPRWLPACR
QKTSFSFLNRPDLPNLAYKKLKGKSPGIVFIPGYLSYMNGTKALAIEEFC
KSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDLADGPQILVG
SSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMK
GVWSMPSKYSEEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDD
IVPWHTSMQVADRVLSTDVDVILRKHSDHQMKEKADIQLLVYTIDDLIDK
LSTIVN
colli-a0a2i0mlj2: Columba livia (Rock dove). Abhydrolase domain containing 10, 1 reference(s)Columba livia Show
LRVALGLPVCRLKSSVSFLTRPDRPKLAYHKLKGRNPGVIFLPGFNSNMN
GQKAMALEDFCNSLGHAFIRFDYTGCGSSDGKFEECTIGKWRKDVLSVLD
ELADGPQILVGSSMGGWLMLHAAIARPDKVAALVGVAAAADHLVTTFKKL
PIEVQKEIEEKGEWKFPTKYNEEGYYSLRYDFIKEAENHCVLNSPIPVTC
PIRLIHGMKDDDVPWQISMQVADRVLSKDVDVILRKTGQHRMSEKEDTKL
LVNTVDDLIDKLATLA
colvi-a0a226nwe6: Colinus virginianus (Northern bobwhite) (Tetrao virginianus). Uncharacterized protein, 1 reference(s)Colinus virginianus Show
MAAALWLRRSGGRAAVPLLGPPLLRAALGIPGSATTSDGCFFRFDYTGCG
SSQGNLEECTIGMWRKDVLSILDELTDGPQILVGSSLGGWLMLHAAIARP
DKVAALVGVAVAADHLVTSFKRLPIEAQKEIEEKGEWKFPTKYNEERYYT
LTYDFIREAENHCVLNAPIPITCPIRLIHGMKDGDVPWQISLQVADRVLS
KDVDVILRKAGQHRMSEKEDTKLLVNTVDDLIDKLAKLT
corbr-a0a091f6y9: Corvus brachyrhynchos (American crow). Uncharacterized proteinCorvus brachyrhynchos Show
VCRLKSSVSFLTRPDRPNIAYQKLKGRNPGVIFLPGFNSNMNGQKATALE
DFCKSLGHAFIRFDYTGCGSSDGKFEECTIGKWRKDVLSILDELTDGPQI
LVGSSMGGWLMLHAAIARPDKVAALVGVAVAADHVVTTFKRLPIEAQKEI
EEKGEWKYQTKHNEEGYYSLTYDFIREAENHCVLNSPIPVTCPIRLIHGM
KDGDVPWQISMQVADRVLSKDVDVILRKIGQHRMSDKEDTKLLVNTVDDL
IDKLSIV
crigr-g3h083: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). Abhydrolase domain-containing protein 10, mitochondrial, 2 reference(s)Cricetulus griseus Show
CRRWGWAAAFFGRHRGLSASLARKTPRAWWLPACRQKVSLSFLNRTDLPN
LAYKKLKGKNPGIIFIPGYLSDMNGTKALAIEEFCKSLGHAYIRFDYSGV
GNSDGNFAECSVGKWRKDVLSILDDVAEGPQILVGASFGGWLMLHAAIAR
PEKVVALIGIATAADDMVTQFRALSVEAQKEVEVKGEWSLPSKYIPEGFY
RIPYGFIKEAEHHCLLHSPIPVTCPVRLLHGMKDDIVPWHTSLQVADRVI
SPDVDVIIRKHSDHRMKEKSDIHLIVCTIDDLIDTLSTAVH
cynse-a0a3p8wch2: Cynoglossus semilaevis (Tongue sole). . Abhydrolase domain-containing protein 10, mitochondrial, 1 reference(s)Cynoglossus semilaevis Show
MAAVSLRCWSRGLSQILSNGGLSALLPRHFEVDKRHKSTVQYASRPDLPK
LAYRRLKGKSPGVVFLPGYGSNMNGQKAVALEEFCKSLGHSYLRFDYTGH
GASEGVLADGTIGTWKKDVLFVLDELAQGPQILVGSSIGGWLMLLAAIAK
PEKTAALVGIATAADHIVTSFNSLPLETRKEFEEKGEWTVPTKHSEEGFY
KFSMNFLQEAENHCVLQSPIPITCPVRLIHGLKDEDVPWHISMQVAERVL
SPDVDVILRRHGLHRMSEKDDIKLMVYTIDDLIDKLTTMV
danre-ABHD10a: Danio rerio (Zebrafish) (Brachydanio rerio) Abhydrolase domain-containing 10a (abhd10)Danio rerio Show
MDMADTPEEKSFVLDLLSKRHQLQLSGVRHKTTIQYATRADLPKLAYRKL
KGKSPGVVFLPGFASHMGGQKAEALEEFCKSLGHSCLRFDYSGCGSSEGE
LTNYTIGAWKKDVLYVLDELVEGPQILVGSSMGGWLMLLAALARPEKTAA
LVGISTAADHFVTAFNALPIETKKEIEEQGFWKFPTKHNEEGFYTLSLDF
LKEAENHCILHSPIPVSCPVRLVHGLKDSDVPWHVSMQVAERVLSNDVDV
VLRKHGQHRMSEKEDIKLMVYTIDDLIDKLTTLG
danre-ABHD10b: Danio rerio (Zebrafish) (Brachydanio rerio). Uncharacterized protein ABHD10b, 1 reference(s)Danio rerio Show
MAAVVLKHCWRGLLHNSGNGAVGTVGFKAFQGVRQKSTVQYISRPDLPKL
AYRRVKGKSPGVVFLPGYGSNMSGPKAEALEEFCKSLGHAYLRFDYSGHG
ASEGVFSEGTIGTWKKDVLFMLDELAEGPQILVGSSMGGWLMLLAAIARP
EKTKALVGISTAADHFVTAFKALPIEVRKECEDKGIWTIPTKSNQEGIYT
VNMDFLQEAENHCILQSPIPITCPVRLIHGLKDEDVPWHISMQVAERVLS
PDVDIILRRHGQHHMTEKDDIKLIVYTIDDLIDKLTTMV
delle-a0a2y9qi19: Delphinapterus leucas (Beluga whale). mycophenolic acid acyl-glucuronide esterase, mitochondrialDelphinapterus leucas Show
MARVGLPSWVPCRRWGWMAVSFGFHRGLSTLLAPKAERAPRWLPACRQKT
SISFLSRPDLPNLAYKRLKGKSPGIIFIPGYMSNMNGTKALAIEEFCKSL
GHAYIRFDYSGVGNSDGNLEECTVGKWRKDVLSIIDDLAEGPQILVGSSL
GGWLMLHAAIARPQKVVALIGVATAVDSLVTQFNQLPVEAKKEIEMKGVW
SMPSKYSEEGFYRIQYSVIKEAEHYCLLHSPIPVNCPIRLLHGMKDDIVP
WHTSMQVADRVVSTDVDVILRKNSDHRMKEKADIQLLVYTIDDLIDKLST
VVK
dicla-e6zir2: Dicentrarchus labrax (European seabass) (Morone labrax). Abhydrolase domain-containing protein 10, mitochondrial, 3 reference(s)Dicentrarchus labrax Show
MAAVALRSCRRGLSHILSNGGLAALSSKRLEGDRRHKSTVQYASRPDLPK
LAYRRVKGKSPGVVFLPGYGSNMNGQKAESLEEFCRSLGHSYLRFDYTGH
GASEGVLAEGTIGTWKKDVLFILDELTEGPQILVGSSIGGWLMLLAAIAR
PEKTAALVGISTAADHIVTVFNSLPLETRKEFEEKGEWTLPTKHSEEGFY
KFSMDFLREAENHCVLQSPIPITCPVRLIHGLKDEDVPWHISMQVAERAL
SPDVDVILRRHGQHRMSDKDDIKLMVYTIDDLIDKLTTLV
dipor-a0a1s3g5m2: Dipodomys ordii (Ord's kangaroo rat). mycophenolic acid acyl-glucuronide esterase, mitochondrialDipodomys ordii Show
MAGVGLSAAAVGWVPCRSWGRVFASLVPHGNVGPLLARKPQRAPPRLPAC
RKMASLSFLNRSDLPNLAYKSLKGKTPGIIFIPGYLSTMNGTKALAIEEF
CKSVGHAYIRFDYSGVGNSDGNLKDCTVGKWRKDVLSILDDIAKGPQILI
GSSLGGWLMLHAAVARPEKVVALIGVATATDALVTQFRQLPVEVQKEVEM
KGVWSMPSKYTEEGYHHIQYSFIKEAEHHCLLHSPIPVHCPVRLLHGMMD
DVIPWHTSMQVADRLLSTDVDVILRKHSDHEMKEKADIQLLVYTIDDLIE
KLSSMPQ
enhlu-a0a2y9jyx5: Enhydra lutris kenyoni (northern sea otter). mycophenolic acid acyl-glucuronide esterase, mitochondrialEnhydra lutris kenyoni Show
MAAAGMASLGAWVPCRRWSKAAVFGFHRGLTALFKRKLEGTPRWLPACRQ
KTSVSFLSRPDLPNLAYKKLKGKSPGVIFIPGYISNMNGTKALAIEEFCK
SLGHAYIRFDYSGVGNSDGNLEECTVGRWRKDVLSIIDDLAEGPQILVGS
SLGGWLMFHAAIARPQRVVALIGIATAVDGLVTQFNQLPVEVKKEVETKG
VWAMPSRYSEDGVYHLQYSFIKEAEHHCLLHSPIPVDCPVRLLHGMKDDI
IPWHTSIQVADRVVSADVDVILRKHSDHRMKEKADIQLLVYTIDDLIDKL
STVVN
erieu-a0a1s2zah9: Erinaceus europaeus (Western European hedgehog). mycophenolic acid acyl-glucuronide esterase, mitochondrialErinaceus europaeus Show
MAGVSMAAVASWLPARRWGRAIVSFGLPRGLGTLLTRNPNWAPRWLPACR
QKTSLSFLNRPDLPSLAYRKLKGKSPGIIYIPGYLSNMNGTKALAIEEFC
KSLGHACIRFDYSGVGKSDGNLQESTVGKWRKDVLSVIDHLAEGPQILVG
SSLGGWLMLHAAIARPGKVVALIGIATAVDGLVTQFNQLPVEVKKEIELK
GVWTMPTKYNEEGFYHIQYSFIKEAEHHCLLHSPIPVNCPVRLLHGMKDD
IIPWHTSIQIADRLISTDVDVILRKHSEHRMKEKADIHLLVCTIDDLIDK
LSVVGI
esolu-a0a3p8z2a3: Esox lucius (Northern pike). Abhydrolase domain containing 10a, 1 reference(s)Esox lucius Show
MPRVRMASTLLARHFRTVFQLNVQRKKKWFSGARDKSTVQYAVRPNLPKL
AYRKVNGKSPGVVFLPGFASNMGGKKAEALEEFCQSLGHSYLRFDYTGCG
SSEGEMVDGTVGTWKKDVLYVLDELVEGPQILVGSSMGGWLMCLAAIARP
ERTAAMVGISTAADHFVTLFNSLPIETRKEIEEEGQWIIPTKYNETGSVT
FTTEFLKEAEQHCVLQSPIPVTCPVRLIHGMKDQEVPWHISMQVAERVLS
NDVDVILRKHGQHRMTEKHDIKLIVYTIDDLIDKLTTLV
esolu-a0a3p9a4q6: Esox lucius (Northern pike).Abhydrolase domain containing 10, 1 reference(s)Esox lucius Show
MAGVALSSCRKGLFNVLRNGGVAALSPNTFGGVRWKSSVQYVARPELPKL
AYRTVKGKSPGVVFLPGYGSNMNGQKAEALEEFCRSLGHSFLRFDYTGHG
LSEGVFSEGTIGTWKKDVLFVLDELAEGPQIMVGSSMGGWLMLLAAIARP
EKTAALVGISTAADHLVTAFKSMPLEVRKEIEEKGVMRVPTKYSEGGVYT
FTVDFLKEAENHCVLQSPIPTTCPVRLIHGMKDADVPWHVSMQVAESVLS
ADVDVILRRNGQHRMSEKDDIRLIVYTVDDLIDKLTTLV
esolu-a0a3p9a519: Esox lucius (Northern pike).Abhydrolase domain containing 10, 1 reference(s)Esox lucius Show
MEVFCAVCGKTRASQAGLPHGQGEESRRGFSAWVWFQYEWPESRGPGRV