Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Bact_LipEH166_FamXII

Bact_LipEH166_FamXII


Genes:Proteins in Bact_LipEH166_FamXII (7)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9bact-b1pz93: uncultured bacterium Lipase, 1 reference(s)uncultured bacterium Show
MLRQFRILLLTLSACFVLFSMSAQAADTLDYGLYWFDGNNTSVKAVEADG
TVNNVPLKYYDPSKPTIVHFHGWQPGAATRGDGYDREDFRFVWGDEDVIT
STSWKNKGWNIAYFYWDQFADESEVKDAEAKMWTANGPRGMRYKLKDGSY
STQFSPNKSVGQIAFEQVTAALAGNTSHYVRLSGHSLGNQLATIVASKIS
DAVYAGSVGNNVTVDRLELLDPFWSADGKAYLGDANGDGANDWVGERTRW
NIETLIQRHNLPVTWYKSSGIQDAWVGDRNTELEGIVTFIHNRFWYLASA
DYLNKHNHVVPWYFRSMASAAPEEVTINWWNQRTQTGKDAASAATDDGRI
RNMMGDTYHWDQVEGRYTADPQDDQFERKNY
9gamm-a3y9m0: Marinomonas sp. MED121 Uncharacterized secreted protein, containing cell adhesion domainMarinomonas sp. MED121 Show
MSISMSGLTYAAQDYLDYGLHWAKMVGGNESQVKAVNHDGSLISQNSSYY
DDSKPTVIYFHGWQNGSAEEGYRRENFEFADINENTMKTWKEQGWNVGIF
HWNQFADEGEVKDAEAKMWSANGNKGMRYRLSDGSYSTTQSPSISVGEIA
FQQISTVLADNTSGNIRFAGHSLGNQLAVFVAQQINDGINSGSLANNLMP
ERIALLDPFWSQDGKSYLGDKNGDGQNDWTGERVRWAINEMIADQDIAVE
WYKTSLIFDVWIGDQNTALESNVALINNRFWYLNAWDITSKHNHARRWYF
QSMDSAAPEEVSINWWGTRSETGYDAASASTSDNRIKFMMGNSYEWDQVE
GRYTADPADDQFEVKDY
9gamm-q1n318: Bermanella marisrubri Uncharacterized secreted protein, containing cell adhesion domainBermanella marisrubri Show
MQKTLRLIAVMIFACGMFIPAMANAALDYGLYWFDGNNNSVKAVEANGKV
NKVQRSFYDPKKPTIVHFHGWQPASGILGREDFNFKGIITSRAWKEKGWN
IAYFYWDQFANELEVKHAEAKMWSTNGPRGMRYKKSDGSYSTQNAPNKSI
GQIAFEQVTAALADNSSNYLRLSGHSLGSQLATIVAGKISDAVTSGSISA
NVMVDRLELLDPFFSKYGKSYLGDANGDGYDDWTGEHVRWTVQTLINRHD
IPVTGYYSSNINDLWIGDKNNGLRSMIAEMWHRYWYLVDEVNKHNHVVPN
YFRSMASAPPEEVTINWWGRRSQTGNVAASASTSDSRVKAMMGNTYYWDQ
VEGRYTSDPADDQFEIKRY
aceaz-d9qsg6: Acetohalobium arabaticum (strain ATCC 49924 / DSM 5501 / Z-7288) Putative uncharacterized protein, 1 reference(s)Acetohalobium arabaticum Show
KVITLDPKRKYVDIGNKIVLRGVKTGLEYQIFIKDDIKDDSGNSLKENHS
FEFKTSDLDYGLYWFGPNGECEKYVDGRKNEYYDPQKPVVIYSHGWQPGL
YESTFTQDQPYIRSTHNYSINTGKIWRKKGYNIGAWMWGQFAAEGFLEDE
IIRVEDAEAKIWFDKNIRYKVRNGSYRYFNQKKSVHEIFYDTYIKALRNN
TNENIRLVGHSIGNQVVITLAHKISNNIKENNLDSHYMPKRIALLDPYWS
NSHFSNGKSIANVISDYAMEMATKNDVVIENYRTTKTSTLIGDLNYALQD
IAAVYRVNAGFLDYLKKLTKFRKEHNYATTWYFWSMKYDIPANNNGVIGA
RASNYKIKQCMNIHRNSTWFWKMNWFGVGNMAGEETPSPYDDEFTMESGV
ISAIGN
cloab-q97db4: Clostridium acetobutylicum, Uncharacterized secreted protein, containing cell adhesion domain, 3 reference(s)Clostridium acetobutylicum Show
MKKIMVSIALLLTIILGLSFNVKASEVNWDRSYWDSLDCGIYWYGMDNKP
YKFVSGQTNPAFDPSKPTIIYIHGWQPEYYLLRHRESFYIYGKDTADDWI
KKGWNVGVFYWNQFSDEIGVLDAEAKIWTTKGPQGMRWRKGDGSYETVNT
VNIPASQLLYQKYVQAMKDYRGNEIRIAGHSLGSQMAILLTQQISDNVDS
GNIPHELLPKRVALLDPYFSNLGKPYLGFKWTGEVCRGYVQNLISTKNIP
FELYTSSDLTRGIAGDDNIGLQKMCATSYMKPTFYNDLQQIERHYAAKYN
YFSSIASNPPLEYANNQLTGNISASASTPTSRIAEMMGPDYHWIQIGGNA
TTDTNDDIYEKHVDSTNY
cloc7-d9smi5: Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3743B) Ig domain protein group 2 domain proteinClostridium cellulovorans Show
MKKKCKMKGKYLALALSLSCIITPQLSYASEVDNTTMASNNGSFINLDWT
KLSWDNLDWNELNYGIYWYGIGNKPYKFIPNETNPAFDPSKPTIIYIHGW
QPNYSLIKHRESFYFYGENAADSWIKAGWNVGVFYWNQFSDELSVEDAES
KIWSPTARNSMRWRKSDGSYDVSSSIKKSSADLLYEEYVKALSGYKGSSI
RIVGHSLGSQMAIRLTKLISDNVDSGAIPPELLPSRVALLDPYFSNLGKE
YLNYRWTGEVARECVSSFINNKNIPFELYKSSALTSGLAGDDNDELKKMC
AYTELKPLFHAPIQQVEKHYDGKYTYFCSYRVSSPAEYVGTTPTGNVAAS
ARTDTQRIAEMMGKKYYWTQAADIFTEDVSDDTFSRSTRNISVSP
spich-f8eyv0: Spirochaeta caldaria (strain ATCC 51460 / DSM 7334 / H1) Putative uncharacterized proteinSpirochaeta caldaria Show
YHPIFKTTAEGSGSSATIRISGPKQGRTYQITINGTITAENGTKLTVNQS
RTYTCANLDFGIWWFSDNGEAQKYLPGVPNQFYNASKPVVLYVHGWQKGS
VTNNYWRENPYLWNDKYTSNVNTGTYWKQKGYNLGVFYWDQFADEDEVKD
AEAKIWVGNNGLKQMRYKLSNGTYVAYSTTKSAADLLYDAYVQAVSSNTS
GYIRLVGHSLGNQMATVLTYKVASAAKSGSLASSLVPKRVYLADPFWNKD
GKTYLGGKWTGEVCRTYINYAISNFGTIVEQSKSTAIGGYLVGDENVDMR
KMTAFFRIWPDFISLTDAALQHSYAVLWYMWSMGGSVQTQNGSLGAAAAD
STVKSMMNYGKTSYYYWYSEGSGNNTSTPFDDSYIRASGVSTW
Sequences



Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer