Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: CMBL

CMBL


Genes:Proteins in CMBL (251)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9aves-a0a091fjn9: Cuculus canorus (common cuckoo). CarboxymethylenebutenolidaseCuculus canorus Show
QMAEPFLYDTGDRSQYGCLGHEVQIEHIKAYVCRPSFYTEKAVIVVHDVF
GWQFSDMRYIVDLIAGHGYISICPDFFKGTDPWKSTDHWADFADWMKNHD
PVKVDKEADVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLKNPQLTAGV
SLYGIIRDSEERYNLLNPTFFIFGEKDHTIAYDQITLLEEKLKQYCKVAY
KIKVYPGQVHGFAQLKPEDMKPDDKPYIEEARKDMIDWISMFV
9aves-a0a091fnm0: Cuculus canorus (common cuckoo). CarboxymethylenebutenolidaseCuculus canorus Show
MANESRPCPCDIGDRFDYGGRGQEVQVEHIKAYVCKPPSSTDKAVIVIHD
IFGWQFPNTRYITDMLTTNGYIAICPDFFVGQEAWKLSNDWTTFDDWLKT
REAGKIDKEVDVVLKYLREQCGAKKIGAVGFCWGGAAVQHLMLKNPHLKT
GVSLYGVIKFMEDRCSLLHPTFFIFAEKDEYITLEQVSLLEQKLKQNCKV
HYEVKIYPGQTHGFVHRKREDINPQDKPYIEGARKDMINWLNKYL
9aves-a0a093c392: Pterocles gutturalis (yellow-throated sandgrouse). CarboxymethylenebutenolidasePterocles gutturalis Show
MANESRPCPCDIGDRFDYGGRGQEVQVGHIKAYVCKPSANTDKAVIVIHD
IFGWQLPNTRYIADMLTTNGYIAICPDFFVGQEAWKPSNDWASFSDWLKT
RDASKIDKEVDVVLKYLIEQCGAKKIGVIGFCWGGAAVHHLMLKNPHLKT
GVSLYGVIRFFEDRYSLLHPTFFIFAEKDDVIPLEQVTLLEQKLKQHCKV
DYKVKVYPGQTHGFVHRKREDIDPQDKPFIEEGRDDMINWLNKYI
9aves-a0a093ckc2: Pterocles gutturalis (yellow-throated sandgrouse). CarboxymethylenebutenolidasePterocles gutturalis Show
QMADPFLYDTGKRSPYGCLGHEVQIEHIKAYVCRPSFFTDKAVIVIHDIF
GWMFPDIRYIVDLIAGHGYITICPDFFKGTDPWKTTDHWADFADWLKDHD
PMKVDKEADVVLKYLKEQCDAKKIGIVGFSWGGMAVHHLMLKNPQLTAGV
SLYGIIRDSEERYNLLNPTFFIFGEKDHTISHDQITLLEEKLKQYCKAAY
KIKVYPGQVHGFAELKPEDMKPADKPYIEEARKDMIDWIKMFI
9cich-a0a3b4esc0: Pundamilia nyererei. Carboxymethylenebutenolidase homolog (Pseudomonas)Pundamilia nyererei Show
MANEAKPCPCDIGDRMEYGALGQEVQMEHFKAYVVKPSTASDKAIIVIQD
IFGWQLPNTRYMADMLAANGYIAICPDFFVGKEPWSPTKDWSNFQEWLQD
KKPTAINKEVDAVLKFLKNQCGAKHIGVVGFCWGGVATHYLALLYPEIKA
GVSVYGIVREREDRYELKSPTLFVFAENDSVIPLDQVSALEANLKEKCKV
DYQVKIFPGQTHGFVHRKREDINPADKPYIQEARKDLLNWLNTYM
9cich-a0a3p9d359: Maylandia zebra (zebra mbuna). Carboxymethylenebutenolidase homolog (Pseudomonas), 1 reference(s)Maylandia zebra Show
MANEAKPCPCDIGDRMEYGALGQEVQMEHFKAYVVKPSTASDKAIVVIQD
IFGWQLPNTRYMADMLAANGYMSICPDFFVGKEPWSPTKDWSNFQEWLQD
KKEVDAVLKFLKNQCGAKHIGVVGFCWGGVATHYLALLYPEIKAGVSVYG
IVREREDRYELKSPTLFVFAENDSVIPLDQVSALEANLKEKCKVDYQVKI
FPGQTHGFVHRKREDINPADKPYIQEARKDLLNWLNTYM
9gobi-a0a3b4b6y7: Periophthalmus magnuspinnatus. Carboxymethylenebutenolidase homolog (Pseudomonas), 1 reference(s)Periophthalmus magnuspinnatus Show
MANEAKPCPCNIGDRLEYGGLGQEVQMDHIHGYVVKPTAASEKAIIVIQD
IFGWKLPNTRYIADMIASNGYIAVCPDFFVGKEPWSPTHDWSKFQEWLED
KKATNIKREVDATIEFLKTKCGAKHIGVVGFCWGGVATHYISLQYPEIKA
AVSVYGVVRMMEDKYDLKSPTLFIFGEKDDYIPLDQVKELEDKLKEKCKM
DYQVKIFPGQTHGFVHRKREDMNPEDTPHIQEARKDMLNWLNKYM
9grui-a0a091kme5: Chlamydotis macqueenii (Macqueen's bustard). CarboxymethylenebutenolidaseChlamydotis macqueenii Show
MANESRPCPCDIGDRFDYGGRGQEVQVEHIKAYICKPAASTDKAVIVIHD
IFGWQLPNTRYMADMLATNGYIAICPDFFVGQEAWKPSNDWATFNDWLKT
RDAGKTDKEVDVVLKYLREKCGAKKIGAIGFCWGGAAVQHLMLKNPHLKT
GVSLYGVIRFFEDRSNLLHPTFFIFAEKDDFIPLDKVNLLEQKLKQNCKV
DYEVKIYPGQTHGFVHRKREDINPQDKPYIEEGRKDMINWLNKYI
9grui-a0a091re20: Mesitornis unicolor (brown roatelo). CarboxymethylenebutenolidaseMesitornis unicolor Show
QMADPFLYHTGERSHYGCLGHEVQIEHIMAYVCRPSFFTDKAVIVVHDIF
GWLFPDIRYIVDLIAGHGYITICPDFFKGTEPWKTTDHWADFADWMKAHD
PTKVDKEADVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLKNPQLTAGV
SLYGIIRDSEERYDLLNPTFFIFGEKDHTISSDQIILLEEKLKEYCKVPY
KIKVYPGQVHGFAQLKPEDMKPDDKPYIEEARKDMIDWVKMFV
9grui-a0a091rr12: Mesitornis unicolor (brown roatelo). CarboxymethylenebutenolidaseMesitornis unicolor Show
MANELRPCPCDIGDRFDYGGRGQEVQVEHIKAYVCKPSANTEKAVIVIHD
IFGWQLPNTRYMVDMLTTNGYIAICPDFFVGQEAWKLSNDWASFNDWLKT
RDSGKIDKEVDVVLKYLREQCGAKKIGVIGFCWGGAAVQHLMLKNPQLKT
GVSLYGVIRFFEDRSSLLNPTFFIFAEKDDHIPLEQVTLLEQKLKQNCKV
DYKVKIYPGQTHGFVHRKREDINPQDKPYIEEGREDMINWLNKYL
9labr-a0a3q3fda5: Labrus bergylta (ballan wrasse). Carboxymethylenebutenolidase homolog (Pseudomonas)Labrus bergylta Show
MANEAKPCPCDIGDRMEYGGLGQEVQIEHIKSYVVKPSAASDKAIIVIHD
IFGWELPNTRYMADMLASNGYTTVCPDFFVGKEPWTPSHDWSTLQEWLKE
RSATDIKKEVDAMLRFLKEQCGAKHIGVVGFCWGGRGTHYLSLNYPDIKA
GVSLYGIIRDQEDRYGLKFPTLFIFGGNDSYIPVNGLEAKLKEKCKTDYQ
VKIFPGQTHGFVHRKNEEMNPDDKPSILEARADLINWLNKYM
9pase-a0a218uhi4: Lonchura striata domestica (Bengalese finch). CarboxymethylenebutenolidaseLonchura striata domestica Show
MANESRPCPCDIGDRFDYGGHGQEVQVGHIKAYVCKPSASTDKAVIVIHD
IFGWQLPNTRYIADMLTTNGYIAICPDFFVGQEAWKPSNDWASFDDWVKT
RDAGKIDKEVDVVLKYLKDQCGAKKIGVIGFCWGGAAVQHMMLKNPHLKT
GVSLYGVIRRFEDKHNLLHPTFFIFGEKDDIIPLEQVTLLEQKLKQNCKV
DYEVKIYPGQTHGFVHRKREDINPQDKPYIEEGRMDMINWLNKYL
9pass-a0a091mls7: Acanthisitta chloris (rifleman). CarboxymethylenebutenolidaseAcanthisitta chloris Show
QMADPFLYNTGERARYGCLGHEVQIEYLKAYVCGPTFLTDKAVIVVHDVF
GWRFPDIRFIVDFIARHGYIAICPDFFKGSEPWKSTDHWGDFADWMKDHD
PMKVDKEADVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLKNPQLIAGV
SHYGIIRDSEERYNLLNPTFFIFGEKDHTISLDQVTLLEEKLQQYCKVQY
KIKVYPGQVHGFAQLKPEDMKPDDKPYIEEARKDMIDWIKMFV
9pass-a0a093pui8: Manacus vitellinus (golden-collared manakin). CarboxymethylenebutenolidaseManacus vitellinus Show
MANESRPCPCDIGDRFDYGGRGQEVQVEHIKAYVCKPSASTDKAVIVIHD
IFGWELPNTRYIADMLTTNGYIAICPDFFVGQGAWKPSNDWATFDEWAKT
RNAGKIDKEVDVVLKYLRDQCGTKKIGVIGFCWGGAAVQHLMLKNPHLKA
GVSLYGVIRRFDDKSNLLHPTLFIFGEKDDIIPLEQVTSLEQKLKQNCKV
DYEVKIYPGQTHGFVHRKREDINPQDKPFIEEGRKDMINWLNKYL
9pass-a0a093q7b3: Manacus vitellinus (golden-collared manakin). CarboxymethylenebutenolidaseManacus vitellinus Show
QMADPFLYNTGDRSHYGCLGHEVQIEYLKAYVCRPSFFTDKAVIVVHDVF
GWQFPDIRYIVDLIAGHGYLAICPDFFKGTEPWKSTDHWADFADWMKDHD
PMKVDKEADVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLKNPQLTAGV
SLYGIIRDSEERYNLLNPTFFIFGEKDHTISLDQVFLLEEKLKQYCKVSY
KIKVYPGQVHGFAQLKPEDMKPDDKPYIDEARKDMIDWIKMFV
9poal-a0a1e5vve9: Dichanthelium oligosanthes. DLH domain-containing proteinDichanthelium oligosanthes Show
MAPAAAAVSAARPSSLPRPSPRRGRSSGACSFRCAAMSARRLSTLVSSSG
PGNYSCSRWRWGRPLCSQAEVAGTTVDDDEACELVSGSDLVIGEGDDSVT
AYLLKAVKNNNGTGILLLSDIFGYEDSATRDFAYRVACNGYNVLVPDLFR
GNPWKLSLPLDDDSFAPWLAGLAPARVSGDIDACTRWLVDEFKAAGVSKK
LGVVGFCYGGGRLVEALARDAERCFSAGVCFYGCPMDASLGDRVAAPVLF
VTGDGDPFCTVETVRELERRARGAKAAVYAGRGHGFAHRPQSLEDDVDAE
DAFNAVRGWLHDHLLA
9poal-a0a2s3hbt0: Panicum hallii; Panicum hallii var. hallii; Panicum miliaceum (Proso millet) (Broomcorn millet). DLH domain-containing protein, 1 reference(s)Panicum hallii Show
MAPAAAAVAAARPSSLPRASSPRRGRQCRACSFRRAAPSARPVTLASSEP
GHCSRSRRRQGRPLCSQAEVAGATVDDDEACELVSGSDLVIGEGDDSVRA
YLFKAVKNNNGTGILLLSDVFGFEDSATRDFAYRVACNGYNVLVPDLFRG
DPWKPSAPFDEDGFARWLAGQAPARVSGDIDACTRWLVDEFKAAGVSRKL
GVVGFCYGGARLVEALARDADAESCFSAGVCFYGSRMDASLGSRVAAPVL
FVCGDGDPLCPVETVRELERRARGARAAVYAGRGHGFAHRPQSVEEDADA
EDAFNAMRGWLHDHLLA
9saur-a0a4d9e0s9: Platysternon megacephalum (big-headed turtle). Carboxymethylenebutenolidase-like proteinPlatysternon megacephalum Show
MTSDAQPFLYDIGKRTGYVGLGHEEQVEHIKAYVCKPSSVTDRAVIVIHD
IYGWQFPDIRYISDLVAAEGYVAICPDFFLGKKPWTSTDHWAEFRDWLKD
RDPTKVDRDADVVLKYLKEHCSAKKIGVIGFCWGGMAVHHLMLKNPELKT
GVAIYGVIKYFEDRYSLLHPTFFIFGENDDYIPLEQVTLLEQKLKQHCKV
YYRVKIYPGQTHGFVHRKREDMNPQDKPYIEEARKDMLNWLNKYL
9saur-a0a402ft50: Paroedura picta. DLH domain-containing protein, 1 reference(s)Paroedura picta Show
MAAKRSHPGSSKAEQGSRSRSSAFAAKLTLFFLSLWPQEHRIRPGKEHSQ
DSSFQMANEADPSPCPAGDLLDYEGLGCEIPVEHINAYLCGPSLPTEKAV
IVIHDIFGWQMPNTRYVVDMLAAKGYLAILPDFYKGQEPWKPSSDWSTFN
EWLKTRDAKKTNKETDVVLKYLKEQHHVRKIGVIGFCWGGAAVHHLMSSY
PDLKAGVSVYGVIRLEGDDCHLLNPTFFIFGEKDEVIPLDQVCILEQKLK
EQCKVHFEVKIYPGQTHGFVHRKKEDMNPKDKPYIEEARKDMMDWLNRYV
9saur-a0a402ft99: Paroedura picta. DLH domain-containing protein, 1 reference(s)Paroedura picta Show
MLCSKDLPFQYDIGRRSNYVGRGQETQMEDIKAYVCQPSFPTGKAVIVVH
DIYGWQFPDTRYIADIIAAEGYLIICPDFFLGKAPWTPNDRWQNFGDWLK
HRDPMKVDTTAEIVMKCLKQQYNVKKIGIVGFSWGGMAAHHLMLTNPELK
TGISAYGIIRDSGDRYTLLNPTFFIFGEKDHTISKDQVTLLEQKLKEYCR
VDYKVKVYPGQVHGFAQCKPEDTRPKDAPYVEEARIDMVAWLDRFLAV
9saur-a0a452hm23: Gopherus agassizii (Agassiz's desert tortoise). DLH domain-containing protein, 1 reference(s)Gopherus agassizii Show
MAVAVMPCTEVSYSTLRYMNLCPFNFASDFQMANEASPCPCDIGDRFEYG
GLGHEVQVEHIKAYVCKPSASTEKAVIVVQDIFGWQLPNTRYMADMLAAN
GYIAICPDFFVGKEPWNPSDDWSTFGEWLKTRDARKIDKEADVVLKYLKQ
QCSAKKIGGVGFCWGGIVVHHLMVKYPELKAGVSVYGIIRDSDDRYNLLK
PTFFIFGEKDDVIPLDQVTLLEQKLKQHCKVDYRVKTYPGQTHGFVHRRR
EDVNPQDKPYIEEARKDMISWLNKYV
9tele-a0a1a7wn71: Iconisemion striatum. Carboxymethylenebutenolidase-like (Pseudomonas)Iconisemion striatum Show
MANEANPCPCDIGDRSDYGGLGQEVQIDHIKAYVVKPSAPSDKAVLVIHD
IYGWELPNTRYMADMLAANGYIAVCPDFFVGKEAWGPTKDWAKFQEWLED
KKPTIINKEVDAVLKFLKEQCGAKRIGTVGFCWGGVATHYLALLYPEIKA
GVSVYGIVREREDRYELKSPTLFIFAENDNVIPLDQVSALEANLKEKCTV
DFQLKIFPGQTHGFVHRKREDINPADKPQILEARTDMISWLNKYM
9tele-a0a2i4aqp9: Austrofundulus limnaeus. carboxymethylenebutenolidase homologAustrofundulus limnaeus Show
MANEANPCPCDIGDRSDYGGLGQEVQIEHIKAYVVKPSTASDKAVVVIQD
IFGWELPNTRYMADMLAANGYTAVCPDFFVGKEAWSPTKDWSGFQEWLKD
KNPTNINKEVDAVLKYLKQQCGAKHIGTVGFCWGGVATHYLSLQYPELKA
GVSLYGIVREREDRYELKSPTLFIFAENDSVIPLDQVSALEANLKEKCTV
DFQVKIFPGQTHGFVHRKREDINPDDKPQIQEARTDMLNWLNKYI
9tele-a0a3b3rr42: Paramormyrops kingsleyae. Carboxymethylenebutenolidase homolog (Pseudomonas), 1 reference(s)Paramormyrops kingsleyae Show
RLLGPPPRRCPETCTMANEAKPCPCDIGDRMDYGASGIEVQLEHIEAYVS
QPAVKSDKAIIVIQDIYGWRLPNTRYMADLLASHGYIAVCPDFFAGKEPW
NPSHDFSTFQKWLEDRKATDINKEVDVVLKYLAKEYGVTRIAVVGFCWGG
VATHHLVLRYPQIKAGVSVYGIIRDDEDRYNLRSPTLFIFGENDAVIPLD
QVTVLEKKLQEKCTVDFQVKIFPGQTHGFVHRKREDINPSDSPFIQEARM
DMLNWLKKYV
9tele-a0a3b3v917: Poecilia latipinna (sailfin molly). Carboxymethylenebutenolidase homolog (Pseudomonas)Poecilia latipinna Show
MANEAKPCPCDIGDRSDYGGLGQEVQIEHIKAYVVKPSAASDKAVIVIQD
IFGWELPNTRYMADMLAANGYTAVCPDFFVGKEPWSPTKDWSTFQEWLKD
KKPTDINKEVDVVLKYLKEQCGAKRIGTVGFCWGGVATHYLALLYPEIKA
GVSVYGIVREREDRYSLKSPTLFIFAENDNVIPLDQVTNLKGKCTVDFQL
KIFPGQTHGFVHRKREDINPADKPQIEEARKDMLNWLNKYI
9tele-a0a3b5aqx2: Stegastes partitus (bicolor damselfish). Carboxymethylenebutenolidase homolog (Pseudomonas)Stegastes partitus Show
MANEAKPCPCDIGDRMEYGGLGQEVQIEHINAYVVKPSTPSDKAIIVIHD
IFGWQLPNTRYMADMLAANGYIAVCPDLYVGKAPWNPSNDWANFMEWLKD
KMPTEINKEVDAVLRFLKEQCRAKRIGVVGFCWGGVATHHLALRYPELKA
GVSLYGIIRDTEDKYDLKSPTLFIFAENDEYVPADQVSTLQANLKEKCKL
DYQVKIFPGQTHGFVHRKREDINPADKPAIQEARTDMLNWLNKYM
9tele-a0a3b5lh80: Xiphophorus couchianus (Monterrey platyfish). Carboxymethylenebutenolidase homolog (Pseudomonas)Xiphophorus couchianus Show
MANEAKPCPCDIGDRSDYGGLGQEVQIEHIKAYVVKPSTTSDKAVIVIQD
IFGWELPNTRYMADMLAANGYTAVCPDFFVGKEPWSPTKDWSTFQEWLKD
KKPTDINKEVDVVLKYLKEQCGAKRIGTVGFCWGGVATHYLALLYSEIKA
GVSVYGIVREREDRYSLKSPTLFIFAENDNVIPLDQVSALEANLKGKCTV
DFQLKVFPGQTHGFVHRKREDINPADKPQIEEARKDMLNWLNKYI
9tele-a0a3q1glr8: Acanthochromis polyacanthus (spiny chromis). Carboxymethylenebutenolidase homolog (Pseudomonas), 1 reference(s)Acanthochromis polyacanthus Show
MANEAKPCPCDIGDRMEYGGLGQEVQIGHIKAYVVKPSTPSDKAIIVIHD
IFGWQLPNTRYMADMLAANGYIAVCADFYVGKEPWSPSHDWANFMEWLQD
KKPTEINKEVDAVLRYLKEQCGAKHIGAVGFCWGGVATHYLALQYPQVKA
GVSFYGIIRNTEDKYDLKSPTLFIFGGNDDFIPAEQVSVLETNLKEKCKI
DYQVKTFPDQTHGFVHRKREDINPADKPSIQEARMDMLNWLNKYM
9tele-a0a3q3ndv7: Mastacembelus armatus (zig-zag eel). Carboxymethylenebutenolidase homolog (Pseudomonas)Mastacembelus armatus Show
MANEANPCPCDIGDRMEYGGLGHEVQIEHTRAYLVKPSTASDKAIIVIHD
IYGWQLSNTRYIADMLAANGYIAVCPDFYVGKEPWSPSHDWSKFQEWYED
KKPTKINKEVDAVLRFLKGQCEAKHIGAVGFCWGGAATHHLALQYPEVKA
GVSVYGIVRDREDIYELKCPTLFIFGEKDEVIPLDQVNALETKLKEKCTV
DYMVKIFPGQTHGFVHRKREDINSTDKPRIQEARTDMINWLKKYM
ailme-d2h9w7: Ailuropoda melanoleuca (Giant panda). Carboxymethylenebutenolidase homolog, 1 reference(s)Ailuropoda melanoleuca Show
MANEAYPCPCDIGHRIEYGGMGREVQVEHIKAYVTKPPFDTGKAVIVIQD
IFGWQLPNTRYMADMIAGNGYTTIVPDFFVGQEPWHPSADWSTFPEWLKT
RDARKIDKEVDAVLKYLKQQCHAQKIGVVGFCWGGVAVHHVMMKYPEFRA
GVSVYGIVKDSEDVHSLKNPTLFIFAENDAVIPLEQVSLLTQKLKKHCKV
EYQIKTFSGQTHGFVHRKREDCSAEDKPYIDEARRNLLEWLHKYV
allmi-a0a151phf3: Alligator mississippiensis (American alligator); Alligator sinensis (Chinese alligator). Carboxymethylenebutenolidase-like protein, 1 reference(s)Alligator mississippiensis Show
MTNRHGVYIPVFQMVERVPPFLYDVGERTEYKPLGHEEQVEHINAYICRP
SFNTDKAVIVIHDILGWQFPDTRYMVDLVAAQGYLAICPDFFKGQPWTTT
DHWADFADWLKKHDPTKVDRETDAVLKYLKEQYGAKKIGVVGFSWGGMAV
HHLMLTNPELQTGVSFYGIIRNTEDRYNLLNPTFFIFGEKDHTISLKQIT
LLEEKLKQYCQVPYFLKVYPGQVHGFAQFKPDDTKPQDKPYIEQARKDMF
DWIEKFV
allsi-a0a1u7rrg3: Alligator sinensis (Chinese alligator); Alligator mississippiensis (American alligator). carboxymethylenebutenolidase homolog isoform X1, 1 reference(s)Alligator sinensis Show
MPEKQTRFHMANEERPCLCNIGDRFDYRGLGQEVQVEHIRAYICKPSSST
DKAVIVIQDIFGWQLPNTRYIADMLAANGYIAICPDYFVGQEPWKPSDDW
SIFNDWLKTRDASRVDREADAVLKYLKQQCGAKKVGVIGFCWGGMAVHHL
MLKNPELKTGVSVHGVIKYFEDRYSLLHPTFFIFGESDEYIPIEQVTIME
QKLKQHCKVDYNVKIYPGHTHGFVHRKREDMNPKDKPFIEEARKDIINWL
NKYI
allsi-a0a1u8cvq6: Alligator sinensis (Chinese alligator); Alligator mississippiensis (American alligator). carboxymethylenebutenolidase homolog, 1 reference(s)Alligator sinensis Show
MANEGRPCPCDIGDRFEYGGLGQEVQVEHIKAYVCKPSCSTDKAVIVIQD
IFGWQLPNTRYMVDMLAANGYIAICPDFFVGKEPWKPSDDWSTFESWLKT
RNARKTDKEVDVALKYLKEQCGAKKIGVIGFCWGGTVVHHLMLKYLELKA
GVSVYGIIKDSDDRYSLLNPTFFIFGEKDVVIALDQVAELEQKLKQHCKV
DYVVKVFPGQTHGFVHRKREDINPQDKPYIEEARKDMINWLNKYI
amaae-a0a0q3pfk6: Amazona aestiva (Blue-fronted Amazon parrot). CarboxymethylenebutenolidaseAmazona aestiva Show
ADPFLYHTGDRSGYGCLGHEVQIEHIKAYVCRPSFFTDKAVIVIHDIFGW
MFPDIRYIVDLIAGHGYITICPDFFKGTDPWKTTDHWADFADWMKHHDPT
KVDKEADVVLKYLKEQCDAKKIGIVGFSWGGMAVHHLMLKNPQLTAGVSL
YGIIRDSEERYNLLNPTFFIFGEKDHTISYDQITLLEEKLKQYCKVEYKI
KVYPGQVHGFAQLKPEDMKPADKPYIEEARKDMIDWIKMFV
ampci-a0a3q0qv51: Amphilophus citrinellus (Midas cichlid) (Cichlasoma citrinellum). Carboxymethylenebutenolidase homolog (Pseudomonas)Amphilophus citrinellus Show
MANEAKPCPCDIGDRMEYGELGQEFQIEHIKAYVVKPSAGSDKAIIVIQD
IFGWQLPNTRYMADMLATNGYIAICPDFYVGKEPWSPSSDWSKFQEWLQD
KKPTNINKEVDAVLKFLKERCGAKHIGAVGFCWGGVATHYLALQYPEVKA
GVSVYGIIREREDKYELKSPTLFIFAENDSVIPLDQVSALEANLKEKCKV
DYQVKIFPGQTHGFVHRKREDINPADTPYIQEARKDMLNWLNKYM
amppe-a0a3p8u449: Amphiprion percula (Orange clownfish) (Lutjanus percula); Amphiprion ocellaris (Clown anemonefish). Carboxymethylenebutenolidase homolog (Pseudomonas)Amphiprion percula Show
MGNEAKPCPCDIGDRMEYGRLGQEVQIEHINAYVVKPSTPSDKAIIVIHD
IFGWQLPNTRYMADMLAANGYMYVESYTDSSIKEPWSPSHDWANFMEWLK
DKKPTEINKEVDTVLRYLKEQCGAKHIGAVGFCWGGVATHYLALQYPQVK
AGVSLYGIIRDTEDKYDLKSPTLFILGGNDDFIPAEQVSILKTNLKKKCK
IDYQVKTFPDQSHGFVHRKREEINPADKPSIQEARMDMLNWLNKYM
anapl-r0ktn0: Anas platyrhynchos (Mallard) (Anas boschas); Anas platyrhynchos platyrhynchos (Northern mallard). Carboxymethylenebutenolidase-like protein, 1 reference(s)Anas platyrhynchos Show
QMADPFLYNTGERSGYGCLGHEVQVEHIKAYVCRPSFFTDKAVIVIHDIF
GWQFPDIRYIVDLIAGHGYITICPDFFKGKDPWKTTDHWHDFADWMKEHD
PVKVDREADVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLRNPQLDAGV
SLYGIIRDSEERYNLLNPTFFIFGEKDHTISHDQITLLEEKLKQYCKVAY
KIKVYPGQVHGFAQLKPEDMKPDDKPYIEEARKDMIDWIKMFI
anapl-r0l8l1: Anas platyrhynchos (Mallard) (Anas boschas); Anas platyrhynchos platyrhynchos (Northern mallard). Carboxymethylenebutenolidase-like protein, 1 reference(s)Anas platyrhynchos Show
MANELRPCPCDIGDKFDYGGRGQEVQIEHIRAYVSKPSASTDKAVIVIHD
IFGWQLPNTRYMADMLTANGYIAICPDFFVGQEAWKPSNDWASFDDWLKT
RQASKIDKEVDVVLKYLKEQCGVKDIGAIGFCWGGAAVQHLMLKNPHLKT
GVSLYGVIRFFDERSSLLHPTFFIFAENDHIVPLEQVTELEQKLKQNCKV
DYKVKIYPGQTHGFVHRKREDINPQDKPYIEEGRKDMINWLNKYM
anate-a0a3q1jxa4: Anabas testudineus (Climbing perch) (Anthias testudineus). Carboxymethylenebutenolidase homolog (Pseudomonas)Anabas testudineus Show
MANEAKPCPCDIGDRMEYGGLGQEVQIEHIKAYVVKPSTVSDKAIIVIQD
VFGWQLPNTRFIADMLATNGYIAVCPDFYAGKEPWSPTGDWSKFQEWLED
KKPNNINKEVDAVLRYLKQQCGAKHIGSVGFCWGGGATHHLALQYPDIKA
GVSVYGILRAKEGRYELKSPTLFIFAEKDEVIPLDQVNVLESKLKEKCTV
DYQVKIFPGQTHGFVHRKREDINPSDKPKIQEARTDMLNWFNKYM
anoca-g1kaz5: Anolis carolinensis (Green anole) (American chameleon). Carboxymethylenebutenolidase homologAnolis carolinensis Show
MANEAKPCPCNLGDKFDYEGQGHEVSVEHIRAYLTKPPHHTDKAVIVIHD
IFGWQLPNTRYIADMLASKGYIAIVPDFYKGQEPWKPSDDWARFDDWRKT
RDSKDTNRETDVVLKYLKEQCNAKKIGVIGFCWGGAAVHHLMLRYSEFKA
GVSVYGVIRFQEDNYNLRNPTFFIFGEKDEHIPLNQVAELEQNLKKQCKT
DFEVKIYPGQTHGFVHRKREDINPEDRPCIEEARKDMLNWLNKYI
antcr-a0a094k2s1: Antrostomus carolinensis (Chuck-will's-widow) (Caprimulgus carolinensis). CarboxymethylenebutenolidaseAntrostomus carolinensis Show
MANELRPCPCDIGDRSDYGGRGQEVQVEHIKAYICKPPASTDKAVIVIHD
IFGWQLPNTRYITDMLTTNGYIAICPDFFVGQEAWKPSNDWATFDDWLKT
RNASKIDKEVDVILKYLSEQCGAKKIGVIGFCWGGAAVHHLMLKNPHLKT
GVSLYGVIRFFEDRSSLLHPTFFIFAEKDEYIPMEQVKQLEQKLKQNCKV
HYEVKIYPGQTHGFVHRKREDINPQDKLYIEEGRKDMINWLNKYL
antcr-a0a094nax2: Antrostomus carolinensis (Chuck-will's-widow) (Caprimulgus carolinensis). CarboxymethylenebutenolidaseAntrostomus carolinensis Show
MADPFRYDTGERSKYECLGHEVQIEHIKAYVCRPSFFTDKAVIVIHDVFG
WLFPDIRYIVDLIAGHGYITICPDFFKGTDPWKTTDHWADFADWMRHHDP
MKVDKEADVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLKNPQLAAGVS
LYGIIRDSEERYDLLNPTFFIFGEKDHTISCDQITLLEEKLKEYCKVAYK
IKVYPGQVHGFAQLKPEDMKPDDKPYIEEARRDMIDWIKMFI
aotna-a0a2k5dtp7: Aotus nancymaae (Ma's night monkey). Carboxymethylenebutenolidase homologAotus nancymaae Show
MANEAYPCPCDIGHRLEYGGMGHEVQVEHIKAYVTKSPVDAGKAVIVIQD
IFGWQLPNTRYMADMISGNGYTTIVPDFFVGQEPWDPSGDWSIFPEWLKT
RNARKIDREITAVLKYLKQQCHAQRIGLVGFCWGGIAVHHLMMKYSEFRA
GVSVYGIVKDSEDIYNLKNPTLFIFAENDAVIPLENVSVLTQKLKEHCKV
EYQIKTFSGQTHGFVHRKREDCSSADKPYIDEARRNLIEWLNKYM
apavi-a0a091mye1: Apaloderma vittatum (Bar-tailed trogon). CarboxymethylenebutenolidaseApaloderma vittatum Show
QMADPFLYNTGERSRYGCLGHEVQIEHIKAYVCRPSFFTDKAVIVVHDVF
GWLFPDIRYIVDLIAGHGYITICPDFFKGTEPWKSTDHWADFADWMKHHD
PMKVDKEADVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLKNPQLAAGV
SLYGIIRDSEERYNLLNPTFFVFGERDHTISYDQITLLEEKLKQYCQVPY
KIKVYPGQVHGFAQLKPEDMKPDDKPYIEEARKDMIDWINMFV
apavi-a0a091n0s0: Apaloderma vittatum (Bar-tailed trogon); Cariama cristata (Red-legged seriema). CarboxymethylenebutenolidaseApaloderma vittatum Show
MANELKPCPCDIGDRFDYGGRGQEVQVEHIQAYICKPSVSTDKAVIVIHD
IFGWQLPNTRYITDMLATNGYIAVCPDFFVGQEAWKLSNDWASFDDWLKT
RNASKIDKEVDVILKYLKEQCGAKKIGAIGFCWGGAAVQHLMLKNPHLKT
GVSLYGVIKFFEDRFSLLHPTFFIFAEKDEVIPLDQVTLLEQKLKQNCKV
DYEVKIYPGQTHGFVHRKREDINPQDKPYIEEGRKDMINWLNKYL
aptfo-a0a087qxk5: Aptenodytes forsteri (Emperor penguin); Pygoscelis adeliae (Adelie penguin). CarboxymethylenebutenolidaseAptenodytes forsteri Show
MANESRPCPCDIGDRFDYGGRGQEVQVGHIKAYVCKAPASTDKAVVVIHD
VFGWQLPNTRYMADMLAANGYIAICPDFFVGQEAWKPSNDWASFDDWLKT
RNAGKIDKEVDVIVKYLSEQCGAKKIGVIGFCWGGAAVQHLMLKNPHLKT
GVSLYGVIRFFEGRSNLLHPTFFIFAEKDDYIPLEQVTLLEQKLKQNCKV
DYEVKIYPGQTHGFVHRKREDINPQDKPYIEEGRKDMINWLNKYL
aptfo-a0a087qxk7: Aptenodytes forsteri (Emperor penguin). CarboxymethylenebutenolidaseAptenodytes forsteri Show
QMADPFLYHTGERSQYGCLGHEVQIEHIKAYVCTPSFFTDKAVIVVHDIF
GWLFPDIRYIVDLIAGHGYITICPDFFKGTDPWKTTDHWADFADWMKHHD
PMKVDKEADVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLKNPQLTAGV
SLYGIIRDSEERYNLLNPTFFIFGEKDHTISYDQITLLEEKLQQYCKVAY
EIKVYPGQVHGFAQLKPEDMKPDDKPYIEEARKDMIDWIKMFI
arath-F12A4.4: Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Carboxymethylenebutenolidase homolog, 2 reference(s)Arabidopsis thaliana Show
MAASLASLSSLAKAGAPRSLFNRHGSHRLPPPQIIPLASSIKKHITTSFY
RRGSSLKNIYALETSDGAINVEVDDDEEEEACELVNGTEVSVDGVEGYLL
TAVKNNNGTGLLLLSDVFGFQDSATRDFAYRVACNGYNVLVPDLFRGDPW
SKNRPKSEYEEWRRGHDPNRIRQDTTTFTKWMVEEFAAAGISKKLGVMGF
CFGGGRVVDVLATDESGYFSTGVSFYGTRIDSAVAGDVKVPVLFIAGDRD
PLCEVKGLYEIEEKIGEGSKVVVYEGRGHGFVHRPETPEDDRDAEEAFAL
MRNWLHHHLI
arudo-a0a0a9sxb7: Arundo donax (Giant reed) (Donax arundinaceus). DLH domain-containing protein, 1 reference(s)Arundo donax Show
MAPTAAAAVAASRPSSLPRAPSLRRGRRDGARSLRCAAPHRLSSASCRAG
HPRSSRQREWRPQLCSQTEVASGTVDDEEACELVSGADLVIGEGDDSVRA
YLLKAVKNNNGTGILLLSDIFGFEDSATRDFAYRVACNGYNVLVPDLFRG
NPWRKSLPTDGFEQWLAGHAPGKVSGDIDACTRWLVDEFTAAGVSRKLGV
VGFCYGGGRLVETLARDAESCFSAGVCFYGSRMDAALGDRIAEPVLFVCG
DGDPLCPVETVRELERRAKGGARAAVYAGRGHAFAHRPQSLEEDADAEDA
FNAMRGWLHDRLLA
astca-a0a3p8qxp7: Astatotilapia calliptera (Eastern happy) (Chromis callipterus). Carboxymethylenebutenolidase homolog (Pseudomonas)Astatotilapia calliptera Show
MANEAKPCPCDIGDRMEYGALGQEVQMEHFKAYVVKPSTASDKAIVVIQD
IFGWQLPNTRYMADMLAANGYIAICPDFFVGKEPWSPTKDWSNFQEWLQD
KKPTAINKEVDAVLKFLKNQCGAKHIGVVGFCWGGVATHYLALLYPEIKA
GVSVYGIVREREDRYELKSPTLFVFAENDSVIPLDQVSALEANLKEKCKV
DYQVKIFPGQTHGFVHRKREDINPADKPYIQEARKDLLNWLNTYM
astmx-w5ln33: Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus). Carboxymethylenebutenolidase homolog (Pseudomonas), 1 reference(s)Astyanax mexicanus Show
MANEARPCPCDIGDKIEYGSLGEEVQIDHIKAYVVKPKAPTEKAIIVIQD
IFGWQLPNTRYMADMVASNGYIAICPDFFVGKQPWSPTDDWATFQQWLED
KNPTKINKEVDVVLKYLKEKCGSKRIGVVGFCWGGVATHYISLQYPEIKA
GVSVYGIVREKEDRYELKSPTLFIFAENDAVIPLEQVTTLEANLKDKCKV
DFQVKIFPDQTHGFVHRKREDINEADRRYIQEARGDLINWLNKYM
balas-a0a384alv8: Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni). carboxymethylenebutenolidase homologBalaenoptera acutorostrata scammoni Show
MANEARPCPCDIGHRIEYGGLGHEVQVEHIKAYLTKSPVDAGKAVIVIQD
IFGWQLPNTRYMADMIAGNGYTTIVPDFFVGQEPWHPSGDWSTFPEWLKT
RDARRIDKEVDAVLKYLKQRCHAKKIGVVGFCWGGVAVHHVMMKYPEFRA
GVSIYGIIKDSEDVYNLKNPTLFIFAENDAVIPLEQVSLLTQKLKENCKV
EYQIKTFSGQTHGFVHRKREDCSPEDKPYIDEARRSLLEWLHKYV
balre-a0a087vbc4: Balearica regulorum gibbericeps (East African grey crowned-crane). CarboxymethylenebutenolidaseBalearica regulorum gibbericeps Show
MANESRPCPCGIGDRFDYEGCGQEVQVEHIKAYVCKPPASTDKAVIVIHD
IFGWQLPNTRYMADMLAANGYIAICPDFFVGQEAWKLSNDWASFDDWLKT
RNAGKIDKEVDVILKYLSEQCGAKKIGVIGFCWGGAAVQHLMLKNPHLKT
GVSLYGVIKFFDDRSSFLHPTFFIFAEKDEFIPLEQVTLLEQKLKQNCKV
DYEVKIYPGQTHGFVHRKREDINPQDKPFIEEGRKDMINWLNKYL
balre-a0a087vbc5: Balearica regulorum gibbericeps (East African grey crowned-crane). CarboxymethylenebutenolidaseBalearica regulorum gibbericeps Show
MANESRPCPCGIGDRFDYEGCGQEVQVEHIKAYVCKPPASTDKAVIVIHD
IFGWQLPNTRYMADMLTTNGYIAICPDFFAGREAWKPSDDWSKFDDWLKN
RDARKINKEADAVLKYLKEQCGAKKLGVIGFCWGGIAVHHLMMTYPELKA
GVSLYGLIKDSDDISNLLNPTFFIFAEKDDFIPLHQVTLLEQKLKKNCKV
DYEVKIYPGQTHGFVHRRREDINPQDKPYIEEGRKDMINWLNKYI
bamth-a0a2p4tbd7: Bambusicola thoracicus (Chinese bamboo-partridge) (Perdix thoracica). DLH domain-containing proteinBambusicola thoracicus Show
FQMADPFLYNTGERSGYGCLGHEVQIEHIKAYVCRPSYFTDKAVIVIHDI
FGWMFPDIRYIVDLIAGHGYITICPDFFKGTDPWKTTDHWHDFADWMKEH
DPVKVDRSLSSLLFICLREADVVLKYLKEQCDAKKIGIVGFSWGGMAVHH
LMLKNPQLSAGVSLYGSVQHMKTYTGLHQIFHSSCKNDDLTNVLFLKCII
GIIRDSEERYDLLNPTFFIFGEKDHTISYDQITLLDEKLKQYCKVPYKIK
VYPGQVHGFAQLKPEDMKPVDKPYIEEARKDMIDWIKTFI
bovin-f1n2i5: Bos taurus (Bovine); Bos indicus x Bos taurus (Hybrid cattle); Bos mutus (wild yak). Carboxymethylenebutenolidase homolog, 1 reference(s)Bos taurus Show
MANEAYPCPCDIGHRIEYGGLGHEVQVEHIKAYLTKSPVDAGKAVVVIQD
IFGWQLPNTRYMADMIAGNGYTTIVPDFFVGQEPWHPSGDWSTFPEWLKT
RNARKIDKEFDAVLKYLKQQCHTKRIGVVGFCWGGTAVHHLMLKHPELRA
GVSVYGIIKDAEDVYGLKNPTLFIFAENDAVIPLEQVSLLTQKLKEHCKV
EYQIKTFSGQTHGFVHRKREDCSPEDKPYIDEARRNLLEWLNKYV
bradi-a0a0q3mph9: Brachypodium distachyon (Purple false brome) (Trachynia distachya). DLH domain-containing protein, 1 reference(s)Brachypodium distachyon Show
MAAVAAAGAVCPSIPCSSGGAACCSLHVVAPAPSTRSTRSLSSPPCRDRS
AAFVAHPRSRSRRLREPRCSQAEMASSGTTVDDDEACELVRGTDLVIGQG
DDESVRAYLLEAVKNNNGTCVLLLSDIFGFEDSATRDFAYRVACHGYNVL
VPDLFRGDPWKKSLPMDGLEAWLGTQAPERVAGDIETCRKWLVEEFLAAA
ESKKLGVVGFCYGGGRLVETLARDADSCFFSAGVCFYGSRMDASLGPRIA
APVLFVCGDGDPLCPVETVRELERGAGCRAVVYAGRGHGFAHRPESLEDD
ADAEDAFARMKAWLHEHLLAAA
brafl-c3yde6: Branchiostoma floridae (Florida lancelet) (Amphioxus). DLH domain-containing protein, 1 reference(s)Branchiostoma floridae Show
MANANNETPCCIGDRLEYGSMGRELKVGGVDMYLATPKTPTKKGVVVYID
IFGWQMPNTRYMVDMIANNGYVAILPDAFQGEEPWTPTSDWSTFNEWMKT
KDPNKIHTVADAAVGYLQQECGVEQLGCVGFCWGGRAVHACLVDRKDFKC
GVAFYGIANKDDEKLGLLNTPGLFIFGENDPVIPLDQVETLKTELKKSCK
VDYHVTVYEGMPHGFAHRKKEENDKDAAAIDGARLEMLKWLEKYM
brarp-m4eh17: Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis); Brassica campestris (Field mustard). DLH domain-containing protein, 1 reference(s)Brassica rapa subsp. pekinensis Show
MAASLVSLSYSIKTGAQPLFNRHGSHRLRPSCPLPLPPSIGKHITSCSRR
QRSMKNPSALETSDGAVNVQVDDDEEEETCELVNRTEVSIDGVEAHLLTA
VKNNNGTGLLLLSDVFGFQDSSTSDFAYRVACNGYNVLVPDLFRGDSWSK
NQPESEYEEWRRGHDMNRILKDTTTLTEWMVDEFAAAGISKKLGVIGFCF
GGGRVVDVLASDKNGYFSTGISFYGTRINSAVAGDVNVPVLFIAGDIDPL
CQVKGLKEIVEKIGEESKVLVFEGRSHGFVHRPETPEDDRDAEEAFSVMR
NWLHQHLLLGN
bucrh-a0a091h0a8: Buceros rhinoceros silvestris. CarboxymethylenebutenolidaseBuceros rhinoceros silvestris Show
QMADPFLYNTGERSQYGCLGHEVQIEHIKAYVCRPSFFTDKAVIVIHDIF
GWQFPDIRYIVDLIAGHGYITICPDFFKGTDPWKTTDHWADFADWMKDHD
PMKVDKETDVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLKNPQLTAGV
SLYGIIRDSEERYNLLNPTFFIFGEKDHTISYDQIILLEEKLKQYCKVAY
KIKVYPGQVHGFAQLKPEDMKPDDKPYIEEARKDMIDWIKMFI
bucrh-a0a091h376: Buceros rhinoceros silvestris. CarboxymethylenebutenolidaseBuceros rhinoceros silvestris Show
MANESRPCPCDIGDRFDYGGRGQEVQVEHIKAYVCKPPASTDKAVIVIHD
IFGWQLPNTRYMADMLTTNGYIAICPDFFVGQEAWKLSNDWASFNDWLKT
RQADNIDKEVDVVLKYLREQCGAKKIGVIGFCWGGAAVQHLMLKNPHLKT
GVSLYGVIRFFEDRSSLLHPTFFIFAEKDEIIPLDQVTLLEQKLKQNCKV
DYEVKIYPGQTHGFVHRKREDINPQDKPYIEEGRKDMINWLNKYL
calan-a0a091hrs7: Calypte anna (Anna's hummingbird) (Archilochus anna). CarboxymethylenebutenolidaseCalypte anna Show
QMADPFLYHTGRRSQYGCLGHEIQIEHIKAYVCTPSFFTDKAVIVVHDVF
GWLFPDIRYIVDLIASHGYTTICPDFFKGTEPWKSTDHWADFADWLRDHD
PMKVDKEADVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLKNPQLAAGV
SHYGIIRDSEERYNLLNPTFFIFGEKDHTISYDQITLLEEKLKQYCKVEY
KIKVYPGQVHGFAQLKPEDMKPDDKPYIEEARKDMLDWIKMFV
calan-a0a091hv38: Calypte anna (Anna's hummingbird) (Archilochus anna). CarboxymethylenebutenolidaseCalypte anna Show
MANESRPCPCDIGDRFDYGGRGQEIQIEHIKAYVCKPPASTGKAVIVIHD
IFGWQLPNTRYMTDMLAANGYVAICPDFFVGQEAWKPSNDWATFDEWRKT
RNASKIDKEVDVTLKYLSEQCGAKKTGAIGFCWGGAAVHHLMLKNPHLKA
GVSLYGVIKFFEDSYSLLHPTFFIFGEKDDIIPLEQVTLLEQKLKENCKV
DHEVKIYPGQTHGFVHRKREDINPQDKPFIEEGRKDMINWLNKYL
calja-u3dfd0: Callithrix jacchus (White-tufted-ear marmoset). Carboxymethylenebutenolidase homolog, 1 reference(s)Callithrix jacchus Show
MANEGYPCPCDIGHRLEYGGMGREVQVEHIKAYVTKSPVDAGKAVIVIQD
IFGWQLPNTRYMADMISGNGYTTIVPDFFVGQEPWDPSGDWSIFPEWLKT
RNARKIDREIDAVLKYLKQQCHAQKIGLVGFCWGGIAVHNLMMKYSEFRA
GVSVYGIVKDSEDIYNLKNPTLFIFAENDAVIPLENVSLLTQKLKEHCKV
EYQIKTFSGQTHGFVHRKREDCSPADKPYIDEARRNLIEWLNKYM
calsu-a0a226nd24: Callipepla squamata (Scaled quail). DLH domain-containing proteinCallipepla squamata Show
MANELKPCPCDIGDQFDYGGRGQEVQVGHIKAYVSKPSASTDKAVIVIHD
IFGWQLPNTRYIADMLTTNGYVAICPDFFVGQEAWKPSNEWSSFDDWVKT
RDAGKIDKEVDVVLNYLKEHCGAKRIGVIGFCWGGAAVQHLMLKNPHLKT
GVSLYGVIKFFDEKCSLLHPTFFIFAEKDEIIPLEQVTLLEQKLKQNNKA
DYEVKIYPGQTHGFVHRKKENINPQDKPYIEEGRRDMINWLNKYM
calur-a0a3q7nnm2: Callorhinus ursinus (Northern fur seal). carboxymethylenebutenolidase homologCallorhinus ursinus Show
MANEAHPCPCDIGHRIEYGGMGREVQVEHIQAYVTKPPFDTGKAVIVIQD
IFGWQLPNTRYMADMIAGNGYTTIVPDFFVGQEPWHPSGDWSTFPEWLKT
RDARKI