Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: DLH-S

DLH-S


Genes:Proteins in DLH-S (173)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9acto-b4uxl0: Streptomyces sp. Mg1 Abhydrolase_5 and PhosphoribosyltransferaseStreptomyces sp. Mg1 Show
AGGTALPGLLTVPKDAEGVVVFAHGSGSSRLSPRNRHVAEVLNRAGLATL
LFDLLTPAEARDRAKVFDVMLLALRLTQSTGWIRARLALRICYFGASTGA
AAALMAAAEPRSDIAAIVSRGGRPDLAVSRLAAVRAPTLLIVGGADDQIL
DLNRQAAAHLRCEHQMGVVPGATHLFEEPGALAAVADAALDWFVRHLPHL
GVVPHRSGEHREM
9acto-b4uyq8: Streptomyces sp. Mg1 PhosphoribosyltransferaseStreptomyces sp. Mg1 Show
TQTGEVAVDAGGTALPGLLTVPEDAAGVVVFAHGSGSSRLSPRNRHVAEV
LNRAGLATLLFDLLTPSEARDRANVFDMPLLALRLTQTTSWLRARVPLRI
CYFGASTGAAAALTAAAEPRSDIAAIVSRGGRPDLAVSRLEAVRAPTLLI
VGGADDQVLDLNRQAAARLRCEHQIGVVPGATHLFEEPGALDAVADAAQD
WFVRHLPHLGTAPRRSNENRQT
9acto-c4rlw1: Micromonospora sp. ATCC 39149 Dienelactone hydrolaseMicromonospora sp. ATCC 39149 Show
MGTTTRGREVTIPAGGAGLPADVLVPAGATGVVLFAHGSGSSRHSPRNVA
VAKVLHERALGTVLVDLLTQEEDRVDARTAELRFDIGLLADRLAEIVDWM
AAEPTLGRLPVGLFGASTGAAAALVAAAARPDQVRAVVSRGGRPDLAGTA
LPQVAAPTLLLVGGLDEQVITLNEQAMAELGEVGELRVVPGATHLFEEPG
ALAQVADAAADWFATHLRPPA
9acto-d3cv20: Frankia sp. EUN1f PhosphoribosyltransferaseFrankia sp. EUN1f Show
SQARAVEVRIPTDTTRLSGDLTIPEHPHGLVVFAHGSGSSRQSPRNRYVS
DVLVDAGLATLLFDLLTPEEELDRKKVFDIDTLARRLIRVTRWLREEPDI
AYLPVGYFGASTGAAAALWAAAEFGPPVTAVVSRGGRPDLAMSRLARVSA
PTLLIVGERDELVLDLNREAQNQLRCESRLAVVPAATHLFTQPGALEAVA
VLARDWFVHHLALAGHPS
9acto-d5zzy5: Streptomyces ghanaensis ATCC 14672 Putative uncharacterized proteinStreptomyces ghanaensis ATCC 14672 Show
MISETVTIPSGEADLTGDLVVPAGARGVVVFAHGSGSSRLSPRNRAVAEA
LRRAGFGTLLMDLLTGDEERRDSATAEYRFDIPLLARRLVDAADWLGRRP
DTADLPAGLFGASTGAAAALVAAAERPGRVSAVVSRSGRPDLADAALPRV
TAPVLLVVGGDDGTVLDLNRRAAEALRAEHAVHVVPGATHLFPEPGALEE
VAGAAAGWFRDHLGTGNGGEPPA
9acto-d6k5b1: Streptomyces sp. e14 CarboxymethylenebutenolidaseStreptomyces sp. e14 Show
YGPSFRTRPAVRAIRLPSGRVPGERRSASAGSMEPSDPGVMPMLSDTVSM
PADRVTLEGDLSVPESAEAVVLIPHDVDTSRRDPHSQAIATRLRAAGWGT
LLVDLLSEREDRGGTERGEQVFDTGLLARRLVAAVDWVGAQPDTRTLSIV
LFGCGTQAASVLEAAAELPDRVLTVVLWGGLPDPTADTVRRLRVPVLFVA
GGREPGVLRLTEKAARRLHAPHEVRVVPEATHLFQGTDVLDQVTAIADEW
CAERLRAARTAARPGR
9acto-d6k8p5: Streptomyces sp. e14 PhosphoribosyltransferaseStreptomyces sp. e14 Show
DREIALDIGAARLTGRLRVPTDAPGVVVFAHGSGSGRHSPRNRFVAASLG
RAGLVSLLFDLLTEEEAGDRTKVFDIGLLAARLAAVTDRLRTLPEAGNLP
VGYFGASTGAAAALRAAAAPDARIAAVVSRGGRPDLTGPALSSVTAPTLL
IVGGADHTVLDLNRQAQTHLTCENHLTTIPGATHLFEEPGTLEAVTDLAR
DWFTDHMSPAHV
9acto-d9wdx8: Streptomyces himastatinicus ATCC 53653 CarboxymethylenebutenolidaseStreptomyces himastatinicus ATCC 53653 Show
MRSETARIAADDALLVGDLALPEHPSAVVAFAHGSGSSRHSPRNRAVAAV
LQGAGLATLLFDLLTDAEERVDAITAEHRFDIPLLGRRLVAAVDWLAGHP
GTSGLPVGLFGASTGAAAALTAAAERPERVRAVVSRGGRPDLAGGVLNRV
RAPVLLVVGGDDHEVLRLNEQAAAMLAAPHEVHVVPGATHLFEEPGALEQ
AAEAARDWFARMAEQRDAQR
9acto-d9y0i3: Streptomyces griseoflavus Tu4000 CarboxymethylenebutenolidaseStreptomyces griseoflavus Tu4000 Show
MVSASVSVPSGGAALPGDLEIPRGARGAVLFAHGSGSSRLSPRNRAVAAA
LREAGFGTLLLDLLTPEEEREDDATGRHRFDIGLLAGRLAHAVDWLERRA
DTMDLPVGLFGASTGAAAALVAATERPGRVAAVVSRGGRPDLAGDALGLV
SCPVLLVVGGDDETVLGLNRRAAGMLTAPHRIHVVPGATHLFPEPGALEQ
VAALAADWFREHL
9acto-g2nkq9: Streptomyces sp. SirexAA-E PhosphoribosyltransferaseStreptomyces sp. SirexAA-E Show
ETVEVEAGGTGLTGDLVLPAATGGVVVFAHGSGSGRHSPRNRAVARTLNR
AGLGTLLLDLLTPGEEADRANVFDIGLLADRLADATRWLRHRVAVPVGSF
GASTGAAAALRAAAATDSGIGAVVSRGGRPDLAGADLAAVRAPTLLIVGG
DDTTVIDLNRRAREALHCENRLEIVPGATHLFEEPGALEQVAELARDWFT
AHLVRKGPGGR
9acto-g6hkb6: Frankia sp. CN3 PhosphoribosyltransferaseFrankia sp. CN3 Show
SPAREIEVDIPAVPVRLAGRLTIPSAARGIVVFAHGSGSSRHSPRNRYVA
DVLTAAGFATLLFDLLTPAEEVDRAAVFDIALLAHRLVDVTSWLRGEPQV
AGLPVGYFGASTGAAAALWAAAEPDSHIAAVVSRGGRPDLAASRLAAVRA
PTLLIVGGDDDLVLELNNQAQAQMQCESRVMVVPEATHLFSEPGALETVA
ALARDWFVRHLDLVASHRGG
9acto-i0kvm9: Micromonospora lupini str. Lupac 08 Putative dienelactone hydrolaseMicromonospora lupini str. Lupac 08 Show
MDEQRSTVTIPVRDAQLPADLMLPAEPVGVVLFAHGSGSSRHSPRNVAVA
RTLTGRGLATVLVDLLTPAEDEVDTRTAELRFDIGMLASRLAGIVDWLAA
ERPAGDVPIGLFGASTGAAAALVAAASRAERVGAVVSRGGRPDLAGAALA
QVRTPTLLLVGGLDEEVITLNERALTELGDVGELWVVPGATHLFEEPGAL
DQVAEHAGAWFTTHLARTTAAPRRS
9acto-i2nba0: Streptomyces tsukubaensis NRRL18488 Uncharacterized proteinStreptomyces tsukubaensis NRRL18488 Show
GEGTEVVIPSGAGVLAGVLAVPPGATGIVLFAHGSGSSRHSPRNRRVAAG
LNRAGLGTLLFDLLTDAEAADRGNVFDTPLLAGRLTDATRRLTGAPGPAG
LPFGYFGASTGAAAALWAAAEPGNRCAAVVSRGGRPDLAADRLPAVTAPT
LFVVGGADSWVLEANRRARAELRTESELLVVDGAGHLFEEPGTLEQVTDA
AARWFTTHFTAAAA
9bact-b9xfz4: Pedosphaera parvula Ellin514 Putative uncharacterized protein, 1 reference(s)Pedosphaera parvula Ellin514 Show
MQTNQVIIPVGPVQLEGEVAIPPEPRGLVVFAHGSGSSRHSPRNHYVARV
LNEAGIGTLLFDLLTAQEEELEAYTRHLRFDIDLLASRLAEATHWVLEQE
FARHLSIGYFGSSTGAAAALVAGAELGDKINSIVSRGGRPDLAGSALEKV
TAATLLIVGGNDQPVITLNEEAYARLQCEKILKLIPGATHLFTETGALER
VSRLASEWFVNHLHPLEHHPL
9bact-d8pej0: Candidatus Nitrospira defluvii Putative uncharacterized protein, 1 reference(s)Candidatus Nitrospira defluvii Show
MESESIFQVRITHDGITLDGILGLPAHPRGVIAFAHGSGSGRFSPRNQFV
ARHLETGGFATLLMDLLTPDEADDRRKVFDIDLLADRLLLAARWLQAHRQ
TAGLQVGYFGASTGAGAALQAAAREPLAVGAIVSRGGRPDLAGPYLSRVT
APTLLLVGGDDGPVIEMNQDALTQLTCRKELVIVPGASHLFEEPGTLEQV
AREALRWFQRYLQPDAQATKESRS
9bact-i0jxd8: Methylacidiphilum fumariolicum SolV Predicted phosphoribosyltransferaseMethylacidiphilum fumariolicum SolV Show
MLNEAIKEEVKVTIGEIYLPGTLEIPPEARGIVLFAHGSGSSRFSPRNQF
VAKVLREKGSGTLLFDLLTSDEEAEDEFSGIYRFDIGLLAKRLVGAAHWL
KIQKQTRNYPIGFFGSSTGGGAALVAAAELGDKIKAVVSRGGRPDLAGES
LKKVKSPTLLIVGSLDEFVLRLNEQALEALQCKKELVIIPGASHLFEEPG
ALNKVAAVAADWFSAHWPQSAILP
9burk-b5wah1: Burkholderia sp. H160 Dienelactone hydrolaseBurkholderia sp. H160 Show
MGSPTAREEVLIQNGSAGLPGMLALPPGAFAVVLFAHGSGSSRHSPRNRY
VAAELNRAGIGTLLMDLLTPQEDAVPATRFDIDLLAARLSRATAWLAAQP
AAALPFGYFGASTGAAAAIRAACTSPIPIRALVSRGGRPDMARPDALAAL
LAPTLFIVGGLDTTVLEQNRAAFALLRCPKELAIVPGATHLFEEPGTLEA
VARLAAQWFERHLRNA
9burk-b5wjp5: Burkholderia sp. H160 Dienelactone hydrolaseBurkholderia sp. H160 Show
MASRLTMQEVTIPVEGARLMGTLALPQNARSLVLFAHGSGSSRFSPRNRY
VAAELNGASIGTMLMDLLSEQEDTGPAARFEIDLLATRLAQATEWIAARQ
SPPLSVGYFGASTGAAAAIRAAWVSSVPIQAIVSRGGRPDLAGRGVLSSV
HVPTLLVVGGLDAHIIELNRAAFALLEGPKDLVIVPGATHLFEEPGTLEA
VARLAVHWFERYLGNSRGNA
9chla-d1rad2: Parachlamydia acanthamoebae str. Hall's coccus Putative uncharacterized protein, 1 reference(s)Parachlamydia acanthamoebae str. Hall's coccus Show
MEKLVQIKHLHVVLEGMLKIPQSAQGIVLFAHGSGSSRLSPRNNFVADIL
NDAGLATLLIDLLSEQEDEIYQTRFDIDLLTERLNIVIQWLKKQSATQNL
GLGIFGSSTGAAAALRSASEMGKEIKAVVSRGGRPDLAIDILDKVTAPTL
FIVGGSDYGVIELNQKAYERLICLKKIRNHPACNASF
9chlr-d6u477: Ktedonobacter racemifer DSM 44963 Dienelactone hydrolaseKtedonobacter racemifer DSM 44963 Show
MQTLPNWNEDTCFIPINENLTLAGNLRVPPEPAGIVVFVHGSGSGRFSPR
NQFVARCLHNIGIATLLLDLLTEQEEILDQVHGHLRFNIALLSERVLGAT
QWLFKQPEVAHLKLGYFGASTGAAAALVAAAQQPRLIAAVVSRGGRPDLA
GDMLEQVQAPTLLIVGSRDEIVIRLNEEAYAHLHVEKHLEIVAGATHLFE
EPGTLEQVATLAGQWFTRHLASQATGTTH
9delt-e1ygc0: uncultured Desulfobacterium sp Putative uncharacterized protein, 1 reference(s)uncultured Desulfobacterium sp. Show
MNGSGETGSYEKQIIISADGKKLKAIMGIPPGSKGLVIFAHGSGSSRLSP
RNNYVAHILQESGLATLLADLLEEAEASDRRKVFDIDLLADRLLSIVNWT
SGNTETRSLISGYFGASTGAGAALQAAAREPGYVKAVVSRGGRPDLAMTY
LPSVKAPTLFIVGGYDEPVISMNEAAYAELNCEKKMFIIPGATHLFEEPG
ALEKAAELASDWFAHYLADNT
9eury-e7qud7: Haladaptatus paucihalophilus DX253 Putative uncharacterized proteinHaladaptatus paucihalophilus DX253 Show
MTGEDTVEIPVDSVRLEGNLHVPSDADGIVLFAHGSGSSRKSPRNNFVAE
RLHEFGLGTLLFDLLTEAEDETYANRFDIELLTDRLVAVTEWVEQRPETE
ERDVGYFGSSTGAAAALRGAARRPEVGATVSRGGRVDLATEVLADVTAPT
LFIVGGRDTQVLELNREAYDRLRCEKELEVVEGAGHLFEEPGTLESVATL
AGEWFSSHL
9eury-g4g2x4: Natronobacterium gregoryi SP2 Dienelactone hydrolaseNatronobacterium gregoryi SP2 Show
MPTTNDTTIPVGDVELEGDLVVPDDADGIVVFAHGSGSSRKSPRNNYVAE
VLRDRGLGTLLFDLLTEAEDQHRENRFDIQLLTDRLVAVTEWLDGRIEKE
RSYGYFGSSTGAAAALRAAARRPDTGAVVSRGGRVDLAEQRLAGVTAPTL
LLVGGEDEHVLRLNREATESVAAVSELHVVEGAGHLFEEPGELEEVADVA
ADWFERFLR
9flao-h7flp1: Flavobacterium frigoris PS1 Putative uncharacterized proteinFlavobacterium frigoris PS1 Show
MKKLEIDIPLTSVTLKGDLVIPENATAIVVFSYGSGSSRFSNRNRMLAEL
IQKQNIGTLLFDLLTEEEDQVYANRFNVDLLVSRLIETTEWLMGYDSAKD
LHIGYFGANTGAASALRAAAYFGDNIKAVVSRSGRPDLALSALHQVTTPT
LLIVGGMDVPVIGMNKMAFDELDTVKEMKIVTGASHLFDEAGKLLEVADL
AITWYKKYLVIKEMSS
9gamm-g4fuh9: Rhodanobacter sp. 2APBS1 PhosphoribosyltransferaseRhodanobacter sp. 2APBS1 Show
EGPVHIPAGQVVLEGDLVSPPSPRGLVLFVHGSGSSRHSTRNRYVASVLN
RRGFSTLLFDLLTPQEDRDTAARFDVPRLARRLDAAVQWVRQQVALRDLP
RGLFGASTGAAAALMVAAARPGEIDAVVSRGGRPDLADTSSLSRVQAPTL
LIVGGADLQVLELNRAAQAAMPQGASLTVVPGATHLFEEPGALEQVAAIA
ADWFARWL
9gamm-g9eqk0: Legionella drancourtii LLAP12 Putative uncharacterized protein, 1 reference(s)Legionella drancourtii LLAP12 Show
MAHYTLDKEHTITIPSDNVSLDGLLYIPKDACGLVLFVHGSGSSRFSVRN
QYVARVLNEGRIATLLFDLFTPEEDAIDSHTRQFRFDIDFLASRLMDATK
WCLKQSVLSPLSIGYFGASTGGGAALVAAAMAPDKIRAIVSRGGRPDLAG
DALALVQAPTLFIVGGHDEIVIQMNKEAMSKLNCIKKIEIIPGATHLFEE
PGALNEVARLARTWFSSYFV
9myco-d5pez5: Mycobacterium parascrofulaceum ATCC BAA-614 PhosphoribosyltransferaseMycobacterium parascrofulaceum ATCC BAA-614 Show
AAADPPIRDEEVTVSAGSVSVAGHLTIPERPVGVVLFAHGSGSSRHSPRN
RYVAEVLNGAGLATLLFDLLTPAEERNRANVFDIELLARRLVDVTIWLGR
ERDTAALPVGYFGASTGAGAALVAAADPRVNVAAVVSRGGRPDLAGPFLP
RVHAPTLLIVGGNDEMVLELNRQAQAAIPGKCELTVVPGATHLFDEPGTL
ERVAVLARDWFIDHLSPAALTANP
9neis-b9z821: Pseudogulbenkiania ferrooxidans 2002 Dienelactone hydrolasePseudogulbenkiania ferrooxidans 2002 Show
MQSGKREVAIPVQEAWLEGHLEIPLGAVGVVLFAHGSGSGRFSPRNNYVA
EVLQEAGIATLLFDLLTREEDQVYQTRFDIALLTERLEAATAWLKRQPDT
AALPVGYFGASTGAAAALRAAAHQGADIAAVVSRGGRPDLAGAAALAQVH
SPTLLLVGELDTEVIRLNQEAQAHMHSPTSLVIIPGATHLFEEPGTLTEV
AEQAARWLRFHFAPGHAPVP
9noca-i0wnf7: Rhodococcus imtechensis RKJ300 Uncharacterized proteinRhodococcus imtechensis RKJ300 Show
RDDDIEVDVGRVRLAGHLVVPEDAIGIVVFAHGSGSSRHSPRNRYVAQIL
NRAGLATLLFDLLTAAEEGDRTLVFDIDLLAERLVAATRWLGTRSDTVGL
PIGYFGASTGAAAALRAGTDSHVDIKAIVSRGGRADLAGERLTEVRTPTL
LIVGSRDETVLDLNRRAQAVIPGTCRIEIVPGATHLFEEPGTLERAAVLA
REWFTTHLPSTLSPPAPQYATIEPECPPGPPSKAT
9noca-i0wrw3: Rhodococcus imtechensis RKJ300 Uncharacterized proteinRhodococcus imtechensis RKJ300 Show
AADPLLRDEEVTVRAGQVSLTGHLTVPENPVGIVVFAHGSGSSRHSPRNR
YVASVLNRAGLGTLLFDLLTAEEETHRARVFDIELLAQRLVAVTRWLGTQ
AEVNDLRIGYFGASTGAGAALRAATDPQVDVAAVVSRGGRPDLAGAELAA
VRAPTLLIVGGSDNVVLELNRRAQAALTCESALAVVPGATHLFEEPGTLE
QVAVLARDWFAEHLAPTRSDEQTGSGTR
9plan-h1mrt9: Singulisphaera acidiphila DSM 18658 Dienelactone hydrolaseSingulisphaera acidiphila DSM 18658 Show
MDATGQGQGGVRSVKVPAGSVTLEGDLGVPAGARGVVLFAHGSGSSRLSP
RNRFVAGALRAEGLATLLIDLLTPEEEAVDLRTRHLRFDIALLAERLVGV
TDWLGADPETLGLKVGYFGASTGGGAALVAAAERPDVVGAVVSRGGRPDL
ARPALAHVKAPTLLIVGGDDEPVIALNREALAQLRCENRLEIIPGATHLF
EQPGTLEAVAMIAGEWFRTHLIAPAGAALSP
9plan-i3iq59: planctomycete KSU-1 Putative phosphoribosyltransferase, 1 reference(s)planctomycete KSU-1 Show
MNQSITIEKHEKEVEILADTVRLQGILGLPLRTKGVVIFAHGSGSGRFSP
RNNFVARVLQDAGIATLLVDLLEESEAMDRQKVFDIDLLAGRLLANTHWV
QDQSEMKDMRIGFFGASTGAGAALQAAAREPNKIAAVVSRGGRPDLAMEH
LSHVQAPTLLIAGGDDKPVIPLNEAAYIRLKCPKELVIIPGATHLFEEPG
ALEKVAQLARDWFIKNFLLKI
9pseu-h5x6i9: Saccharomonospora marina XMU15 Putative phosphoribosyltransferaseSaccharomonospora marina XMU15 Show
PVRDEEVEVLAGEVALEGRLTVPEHCPGVVLFAHGSGSGRHSPRNRHVAA
VLNEARIGTLLFDLLTQEEEFDRRYVFDIELLADRLIGATRWLRDQPGFE
RTPIGYFGASTGAAAALWAAADARTDVAAVVSRGGRPDLAGKQLRAVGAP
TLLIVGGHDHVVLDLNRAAQAELHCENELAVVPRATHLFEEPGALDHAAQ
LARGWFLGHLAS
9pseu-h5xbl8: Saccharomonospora marina XMU15 Dienelactone hydrolase-like enzymeSaccharomonospora marina XMU15 Show
MTVPFDVTTETAALAGDLTVPADARGVVAFAHGSGSSRHSPRNIAVAKTL
QDNQLATLLFDLLSSDEEELDRQTARLRFDIDLLTARLVTAVDQLSKGEH
TRGLPIGLFGASTGAAAALAAAARRPDLVQAVVSRGGRPDLAGDALEDVR
APVLLVVGERDRQVLTLNEQAARRLRAPHEIQVVSGATHLFEEPGALQRV
AELAGDWLRTYLTERQDASPS
9pseu-h5xjm4: Saccharomonospora cyanea NA-134 Dienelactone hydrolase-like enzymeSaccharomonospora cyanea NA-134 Show
MTVPFGVAAGSAALSGDLTVPSDALGVVAFAHGSGSSRHSPRNVAVARSL
QDRRLATLLFDLLSEDEERYDAATGELRFDIGLLADRLVTAVDQLREDTT
TRNLPIGLFGASTGAAAALVAASRRPEAVRAVVSRGGRPDLAGDALTEVE
CATLLVVGGSDTQVLRLNEQAAHRLAGPHALEIVPGATHLFEEPGALEQV
AELAGTWFTRQLTG
9pseu-h8g3c2: Saccharomonospora azurea (strains NA-128; SZMC 14600) Dienelactone hydrolase-like enzymeSaccharomonospora azurea NA-128 Show
MTVPFGVATGATALSGDLTAPADAIGVVAFAHGSGSSRRSPRNVAVARSF
QDRRLATLLFDLLSEDEARHDAATGSLRFDIGLLADRLVTAVDRLSADAT
TRALPIGLFGASTGAAAALVAASRRPELVRAVVSRGGRPDLAGHALGDVD
APTLLIVGGADTQVLRLNQQAAHRLTGPHRLEVVPGAGHLFEEPGALEQV
ADLAGTWFTQHLAA
9pseu-i0uxj8: Saccharomonospora xinjiangensis XJ-54 Dienelactone hydrolase-like enzymeSaccharomonospora xinjiangensis XJ-54 Show
MTVPFGVAAGTAALSGDLTVPSDALGVVAFAHGSGSSRHSPRNVAVARSL
QDRRLATLLFDLLSREEERRDAATGELRFDIGLLADRLVNAVDQLGEDAT
TRALPIGLFGASTGAAAALVAAARRPELVRAVVSRGGRPDLADDALPDVE
CPTLLVVGGADTQVQRLNEQAASRLSAPHELRIVPNATHLFEEPGALEAV
ADLAGEWFTRHLPR
9pseu-i1d136: Saccharomonospora glauca K62 Dienelactone hydrolase family proteinSaccharomonospora glauca K62 Show
MTVPFGVGVESATLPGELTVPADAIGVVAFAHGSGSSRHSPRNTAVARSL
QDHRLATLLFDLLSTAEERRDSATGELRFDIGLLADRLVAAVDRLVADPA
TRGLPLGLFGASTGAAAALVAAARRPEVVRAVVSRGGRPDLAGDALSEVE
CPTLLVVGGSDTQVLRLNERAAHRLAGPHELEVVPKATHLFTEPGALERV
AELAAEWFARHLPS
9rhiz-e8l1r9: Methylocystis sp. ATCC 49242 Erythromycin esterase, 1 reference(s)Methylocystis sp. ATCC 49242 Show
MTTKDFKVISVAVGQYGLEGSLYLPSDPVGIIIFAHGSGSSRFSPRNIFV
AKQLVKCGFACLLFDLLTSDEARDRRNVFDIPLLGARVAEAVSWALANPI
VSGAPVGLFGASTGAAAALVAAAQAALRISAVVSRGGRPDLAGTALGQVQ
APTLLIVGGLDHEVIELNKEALGKLNCVAQLEIVPGATHLFEEPGTLEHV
VERAAAWFLEHIHGPAFGRDGAGRE
9rhiz-h0hm22: Mesorhizobium alhagi CCNWXJ12-2 Putative uncharacterized protein, 1 reference(s)Mesorhizobium alhagi CCNWXJ12-2 Show
MSEVLSNDVREVRVEPEGLGGLLGVPDGARGIVAFAHGSGSGRLSPRNNH
VAAALRQAGLATFLLDLLTPEEEHDRRNVFDIDLLAGRLVLATRWLRQRR
ETSQLAVGYFGASTGAAAALRAAAAEPDIAAVVSRGGRPDLALEVLPAVR
APTLLLVGSRDGPVIGMNEQAYHALRAEKRLVIVEGAGHLFEEPGTLDEV
VRHATQWFLDHLNPSVERT
9rhob-a6fnq7: Roseobacter sp. AzwK-3b Dienelactone hydrolaseRoseobacter sp. AzwK-3b Show
MENSSHIEVFITVAKGAMILSGTLSMPETPSGLVIFAHGSGSSRMSPRNR
YVADRLNAAGLATLLFDLLTEEEALDKRNVFDIALLANRVGAALNWCTCE
TRVRDLPCGLFGASTGAAAALRAAADHPRVVRAVVSRGGRPDLAKSALPR
VLELPPLSGPS
9rhob-b7rr68: Roseobacter sp. GAI101 Protein-L-isoaspartate (D-aspartate) O-methyltransferaseRoseobacter sp. GAI101 Show
EKTQTHKRQVSIPPLGLPGDLTVPSNPRGIVLFAHGSGSSRLSPRNRYVA
EKLNEKGFATILFDLLTPQEEQDRRNVFDIPLLADRVVEASIWITSEPDL
EDLPLGLFGASTGGGAALVAAAELKDRVGAVVSRGGRPDLAMDFLAQVIS
PTLLIVGSLDRDVIKLNQQALAALTCTKRLEIVPGAGHLFEEAGTLDLAV
GHAAEWFKTHL
9rhoo-h0q5m3: Azoarcus sp. KH32C Dienelactone hydrolaseAzoarcus sp. KH32C Show
MIRQASNETIRIPSGDIFLEGMLQWPSQPASGIVVFAHGSGSSRLSPRNN
FVAAELRQSGLATLLMDLLTLEEDADYTNRFDIDILTDRLLDAMSYLDKE
AVTASLPVGAFGASTGAAAALRLSAALPDRVAAVVSRGGRPDLAGSEILT
RIRTPTLLIVGSLDTPVIELNEAAYRDLGGIKEIRIVPGATHLFEEPGTL
EQVAKLAAAWFNRYL
9sphn-f6idx6: Novosphingobium sp. PP1Y Putative uncharacterized protein, 1 reference(s)Novosphingobium sp. PP1Y Show
MIAPLPSTGLKEVQIGPHALAAILGVPAGARGLVIFAHGSGSGRLSPRNN
YVAARLRDDGLATILLDLLTPEEEHDRRNVFDIALLAERLSGAADWTRDH
PETSDLRPCYFGASTGGGAALRAAADDPRIAAIVSRGGRPDLAGADMLPR
VQAPTLLIVGELDGIVIDLNAAAYDALRCEKDMAIVPGAGHLFEEPGTLD
QVVTLASLWFRHHLGNVL
9sphn-g6efp8: Novosphingobium pentaromativorans US6-1 Putative uncharacterized protein, 1 reference(s)Novosphingobium pentaromativorans US6-1 Show
MSAPLPSTALEEVRIGEHGLAALLGVPADAKGLVIFAHGSGSGRLSPRNN
YVAAHLRDDGLATLLLDLLTPEEEHDRRNVFDIALLSTRLHQAVDWAQGH
PRTRTLRPCYFGASTGGGAALRAAADDPRIAAVVSRGGRPDLAGQAVLPK
VLAPTLLIVGELDGIVIDLNAAAYDALTCEKDMAIIPGAGHLFEEPGTLE
QVVTLASLWFRHHLGEAR
9zzzz-e6pt64: mine drainage metagenome Putative hydrolasemine drainage metagenome Show
MQRPATIDVQIPTHDVVLDGILALVGGARGIVVFAHGSGSSRFSRRNRDV
AEALQAAGLATLLFDLLSAEENARDRMTAEHRFDIALLARRLTDTVDWLG
QEAATRALHIGLFGASTGAAAALITAAERPQRVDAIVSRGGRPDLAGDAL
GKVQAPTLLIVGGWDPEVIALNALAARQLTCAHRTAIVPNATHLFEEPGK
LEQVSRLAAAWFATHLSATNS
9zzzz-e6q8q6: mine drainage metagenome Putative hydrolasemine drainage metagenome Show
MVGSERSVHISAEGVRLEGNWVIPENALGLVLFAHGSGSSRLSPRNNYVA
QVLRDGGIATLLFDLLTEEEDRVYATRFDIGLLSERLALATRWTQRQPEA
AGLPLGYFGASTGAAAALRAAAQFGDAIAAVVSRGGRPDLTGPAISRVTA
PTLLIVGGLDDVVIGMNETAYAELRAEKQMVIVPGATHLFEEPGTLEEAA
SLALAWFQRHFKK
9zzzz-e6qrn9: mine drainage metagenome Putative hydrolasemine drainage metagenome Show
MTALLEQLVHIPSDTIHIEGMLELPEDAQGIVLFAHGSGSSRHSPRNNYV
ARVLREAGFGTLLMDLLTQQEDMNYETRFDIPLLTHRLLDATRWISLEPT
TQNLPTGYFGASTGAAAALQAAAQSTHNIAAVVSRGGRPDLAGAAALGKV
RAPTLLLVGGFDDVVIELNQSAYDLLNCQKVFTIIPGATHLFEEPGTLEQ
VAHQAAAWFKKYLTSSR
acide-c5tay0: Acidovorax delafieldii 2AN Dienelactone hydrolaseAcidovorax delafieldii 2AN Show
MQATTPQLVRIPVGRGHVEGALEASHHSQGLVIFAHGSGSSRHSPRNNYV
ARVLRERRLATLLVDLLTPEEDRTPALRFDIPLLTQRLLVVTDWARRQPA
TAPLPLGYFGASTGAAAALRAAAALGSVIRAVVSRGGRPDLAPARDLAQV
QCPTLLVVGGCDEEVLALNRSAAAQMPGPKALAIVPGATHLFEEPGALEA
VAGLAADWFVQHLTAPGAPASGGQ
acif2-b7j4u5: Acidithiobacillus ferrooxidans (Ferrobacillus ferrooxidans) (Leptospirillus ferrooxidans) Acidithiobacillus sp. Putative uncharacterized protein, 1 reference(s)Acidithiobacillus ferrooxidans Show
MVGSERSVHISAEGLRLEGNWVIPENALGLVLFAHGSGSSRLSPRNNYVA
QVLRDGGIATLLFDLLTEEEDRVYATRFDIGLLSERLALATRWTQRQPEA
AGLPLGYFGASTGAAAALRAAAQFGDAIAAVVSRGGRPDLTGPAISRVTA
PTLLIVGGLDDVVIGMNETAYAELRAEKQMVIVPGATHLFEEPGTLEEAA
SLALAWFQRHFKK
actm4-i0hcs6: Actinoplanes missouriensis (strain ATCC 14538 / DSM 43046 / CBS 188.6 / JCM 3121 / NCIMB 12654 / NBRC 102363 / 431) Putative dienelactone hydrolaseActinoplanes missouriensis Show
MTSWKTQERINAGGVRLDGDLTLPEHPAGLVIFAHGSGSSRHSPRNQIVA
AELNQYGFATLLADLLTPDEEVADERTGLLRFDIGLLADRVIGIIDWARN
HPPTAALAFGLFGASTGGGAALVAAAARPEAVRAVVSRGGRPDLAGPALL
EVRAPTMLIVGERDVNVVDLNEQARNTMRISAELRVIAGATHLFSEPGAL
EQVAEEAAGFFQMHLAVPVSP
acts5-g8s8q3: Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) Dienelactone hydrolaseActinoplanes sp. Show
MTTWTTTERIDLGPVRLEADLTLTEHATGVVLFAHGSGSSRHSPRNRAVA
RELHRRGFATLLADLLTTREDTRPQRFDIGLLADRLVGLVDWLRAQPATA
PLPLGLFGASTGAAAALVAAAARPEAVRSIVCRGGRPDLAGPALIEVLVP
TLLIVGSRDEAVLELNEQARNTMRVHAELRIIPDATHLFEEPGALETVAE
QAGEWFGAFLTAVPYRRHPALDHVATARRWG
acts5-g8sis1: Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) Dienelactone hydrolaseActinoplanes sp. Show
MRIHAAGTLLDGDLTVPPDAAGMVLFTQNGPRDRAVAAALHEVSLATLLI
EPLTAPERGDDTRRFDVDLVADRVIGTLRWLRAQPVTTYLPIGLFGAGVN
AAAALVAAAARPGDVQTVVTRGGRVDLAGGALAQLMAPALFIVGERDQRL
RLLNEESRQAARSHADMCVIPGADRFFSGTQALRQVTVQAADWFRIHLAA
PVPQRPPEIDTALPVEHSSLIDMFPAPSTTQERCPDDA
alidb-e8tue2: Alicycliphilus denitrificans (strain JCM 14587 / BC) Dienelactone hydrolaseAlicycliphilus denitrificans Show
MASPHEQLVRIPVDQAHVEGLLALPAAPIGVVLFAHGSGSSRHSPRNNYV
ARVLHARGVGTLLLDLLTPEEDRDYRTRFDIALLTQRLRAAARWLGRQQL
TRSLPMGYFGASTGAAAALMAAAAQGRDIRAVVSRGGRPDLAGPEALARV
ACPTLLVVGSRDDEVLELNRQAASLMRCPHRLSVVPGATHLFEEPGTLEA
AARQAADWFEKYLQPA
alidk-f4g7l1: Alicycliphilus denitrificans (strain DSM 14773 / CIP 107495 / K601) Dienelactone hydrolaseAlicycliphilus denitrificans Show
MASPHEQLVRIPVDQAHVEGLLALPAAPIGVVLFAHGSGSSRHSPRNNYV
ARVLHARGVGTLLLDLLTPEEDRDYRTRFDIALLTQRLRAAARWLGRQQL
TRSLPMGYFGASTGAAAALMAAAAQGRDIRAVVSRGGRPDLAGPEALARV
ACPTLLVVGTRDDEVLELNRQAASLMRCPHRLSVVPGATHLFEEPGTLEA
AARQAADWFEKYLQPA
anadf-a7h927: Anaeromyxobacter sp. (strain Fw109-5) PhosphoribosyltransferaseAnaeromyxobacter sp. Fw109-5 Show
EVLAIPFDGGPEPGVLEAELAVPPGAKGLVMFVHGSGSTRRSPRNQLVAR
GLQRAGFATLLFDLLTPAEALEDEVTTELRFDIALLTGRVVAATRWVASL
PRTRELRIGYFGASTGASAALAAAALLPELVAAIVSRGGRPDLVRAETLL
QVRAPVLLVVGSRDTTVLRLNRSVLPYLRAGELSVVPGATHLFEEPGALD
SVTRLAARWLERQFTAPAALGTRPVA
anadf-a7hfj8: Anaeromyxobacter sp. (strain Fw109-5) Putative uncharacterized proteinAnaeromyxobacter sp. Fw109-5 Show
MDLAGDLALPPGARGIVVFVHGSGSSRHSPRNQFVAHELHQAGLATLLFD
LLTPAEEEHDRFTGELRFNIGFLADRLGDVTEQVRRHPETRHLPIGYFGA
STGAAATLVAGAERPAEVAAIVSRGGRPDLAGGALEKVVAPTLLIVGGED
HRVLDLNEQAFLRLRCTKRLEIVPGRHICSRSRGRSVQWRAWRPRGSGTS
SPGRSRLTSIPARRLRILRRRKCHDA
anavt-q3m5q1: Anabaena variabilis (strain ATCC 29413 / PCC 7937) dienelactone hydrolase, 1 structure(s).e.g. Anabaena variabilis Show
MDRTLTHQPQEYAVSVSVGEVKLKGNLVIPNGATGIVLFAHGSGSSRYSP
RNRYVAEVLQQAGLATLLIDLLTQEEEEIDLRTRHLRFDIGLLASRLVGA
TDWLTHNPDTQHLKVGYFGASTGGGAALVAAAERPETVQAVVSRGGRPDL
APSALPHVKAPTLLIVGGYDLPVIAMNEDALEQLQTSKRLVIIPRASHLF
EEPGALTAVAQLASEWFMHYLR
aroae-q5p4m0: Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) Putative uncharacterized protein, 1 reference(s)Aromatoleum aromaticum EbN1 Show
MTSQAEKSSGAGRAVEIPVGAVRLGGELTIPHGAAGIVLFAHGSGSSRHS
PRNRFVARFLCDAGIGTLLFDLLSLDEEAVDARTGELRFDIGLLAGRLGE
ATRWLRRQPDAADLPLGYFGASTGGAAALVAAAALGDEVRAVVSRGGRPD
LAGDALEAVRAATLLLVGGRDEPVIRMNQEAYARLSCTKALTIVPGATHL
FEEPGTLEAVAQHAATWFRRHLPQAA
artpp-f0m5g1: Arthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LM 23796 / Sphe3) Putative phosphoribosyltransferase, 1 reference(s)Arthrobacter phenanthrenivorans Show
GVDQDVEIAVDGVTLHGDLHLPAQCGAVVVFAHGSGSSRHSPRNRYVASV
LQGAGLGTLLLDLLTPAEEVDRGNVFDIALLAQRLIAANHWLTGRDDTAG
CRVGYFGASTGAGAALWAAAEPGAEVDAVVSRGGRPDLAGPRLAAVRAPT
LLLVGGADTQVLALNRQAMDQMTAPVRLEIIPGATHLFEEPGTLTRAATL
AKGWFARYLLPETAPERASEVPS
arts2-a0k0l7: Arthrobacter sp. (strain FB24) PhosphoribosyltransferaseArthrobacter sp. Show
AVDEDVQIEAGAARLQGHLYVPVEGAAVVVFAHGSGSSRHSPRNRFVASF
LQRAGLGTLLLDLLTPAEELNRANVFDIGLLAGRLTGATEWLAGRPETAR
SRVGYFGASTGAGAALWAAAEPGARIGAVVSRGGRPDLAGDRLSAVRAPT
LLIVGGADREVLELNRWAQALLRCPSQLSVVPGATHLFEEPGTLSEAAAL
ARDWFLRYLQPGGDGAGD
azobr-g8al65: Azospirillum brasilense Sp245 Putative uncharacterized protein, 1 reference(s)Azospirillum brasilense Sp245 Show
METTLYIPPLGLAGQFEAPADFAAAVIFAHGTSSGRKSPRNVRVAARLRE
AGFATLLMDLLTEGEKADPANQFDVHRQSEHLLLAVRHLRATTAVERKPI
GFFGAGSGAASALIAAGRAAEHDSIGAVVCRGGRPDLAEEWLNAVAAPTL
LVVGGKDAPALDLNNDAFSRLHCTKALEVVPGAGRLFEETGKLDQVADSA
RSWFTTHLLKAANG
azovd-c1dis2: Azotobacter vinelandii (strain DJ / ATCC BAA-1303) Putative uncharacterized protein, 1 reference(s)Azotobacter vinelandii Show
MRFPLGKVRLHGDLIAPEDAQGLVVFVHGSGSSRHSPRNRSVARFFNGLG
MATLLFDLLTEEEQPIDEVSRQLRFDIPLLSERLSGVVDQLRANADLRDL
KLGLFGASTGAAAALIAAAARPADIAALVSRGGRVDLATDVLEKVHAPSL
FIVGELDSEVLALNRQAAGRLRCQHELAVVPGATHLFEEQGKLEEVERLA
GQWFLQHLAG
bdeba-q6mgv6: Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 952 / HD100) Putative uncharacterized protein, 1 reference(s)Bdellovibrio bacteriovorus Show
SQSTAEQITIVDGPKKLTGDLTRVKNSKGLILFAHGSGSSRLSPRNRKVA
TELNKRGFSTLLFDLLTDSEAEDRRNVFNIALLARRLLCATDTVVEVYQG
KTPPLGYFGASTGAGAALTAAAQSTHPISAVVSRGGRPDLADEFLSQVLA
PTLLIVGGNDTQVIELNAMAERKIGKVKMAVVPGATHLFEEPGAMEKVIE
LAANWFSQNLSAAKAPHPQEPPVRPGGL
beii9-b2ii20: Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCI 8712) Putative uncharacterized proteinBeijerinckia indica subsp. indica Show
MSQLFLEKVEDVRIEPENLSGLLGVPEGAQGIVIFAHGSGSGRMSPRNNY
VAAALRQAGLATFLLDLLTPAEEQDRRNVFDIDLLAARLTRATQWIAEKP
ETAALVPGYFGASTGAGAALKAAARPQSDVAAVVSRGGRPDLALDVLPHV
RAPTLLLVGSLDGPVIGMNQRAFDALPGKKKIIIVEGASHLFEEPGTLDE
VVRHATDWFLTYLGHPRQRR
blasd-h6rlp5: Blastococcus saxobsidens (strain DD2) Uncharacterized proteinBlastococcus saxobsidens Show
DPAAAPVRRTVEVPSSEAALAGDLVVPRAARGVVLFAHGSGSSRHSPRNQ
QVAAALHDAGFGTLLLDLLTEAEEQVDARTRELRFDIGLLAGRLTDAADW
LGRAEGTAGLSLATFGASTGAAAALITAADRPSRVAAVISRGGRPDLAGD
ALGRVRAPTLLVVGGADAQVLDLNREAAARLTAEHEIAVVPGATHLFPEP
GALEQVIDRTVDWLGRWLPSATADVRPCGAPRP
burp1-q3jvq2: Burkholderia pseudomallei, Burkholderia thailandensis, Putative uncharacterized protein, 2 reference(s)Burkholderia pseudomallei Show
MQIHEVRIPIGKVELNGLLAAPEQASGIVVFAHGSGSSRLSPRNQEVAAV
LQRAGLATLLFDLLTLEEQRRDAVTAEYRFAISFLARRLVSALDWLRERP
DVGALPVGLFGASTGAAAALIAANARGRVVRAVVSRGGRPDLAGDALPRV
RVPTLLVVGERDDEVLRLNRVAAGWLIGESKLVVVPGATHLFEEPGTLDE
VARVAADWFVAHLGEGRPSPEGARR
burp8-b2jtz3: Burkholderia phymatum (strain DSM 17167 / STM815) Dienelactone hydrolaseBurkholderia phymatum Show
MQTLQVEIPVDYVKLGGILDIPDNPRAVVVFAHGSGSSRFSPRNRQVAAG
LQRAGLATLLFDLLTLEEQQHDEVDATYRFNIPLLARRLGSTLVWLRQRA
DVASLRVGLFGASTGAAAALVAAAEGSIVDAIVSRGGRPDLAREALDLVS
TPTLLIVGELDAEVIRLNRKAAVQLTCEHDIAIVAGATHLFEEPGALDEV
TRLAVSWFVRWLTAPSS
causk-b0syi8: Caulobacter sp. (strain K31) Erythromycin esteraseCaulobacter sp. Show
GPGVGIGAVERREVRLPPIGLTGDLQVPKGAKGIVVFAHGSGSSRLSPRN
RAVADDLNARGMATLLFDLLGEAEAADRRKVFDIDLLAERLVDATAWIAG
QPDLAGLPLGLFGASTGAGAALVAAAKLGERVCAVVSRGGRPDLAGAALR
RVSAPTLLIVGGADHQVIELNRQALAELRGDKALRIVPGAGHLFEEAGAL
EQVMHLAGDWF
corcm-h8mes4: Corallococcus coralloides (strain ATCC 25202 / DSM 2259 / NBRC 10008 / M2) (Myxococcus coralloides) Uncharacterized proteinCorallococcus coralloides Show
MAEHRISEHAVRLEAEPGVELDGTLSVPERVSGVVLFAHGSGSSRFSPRN
QYVARVMQRAGLATLLMDLLTPGEEEAERLTRHLRFDIELLAGRLVGATR
WLAQVPGLGGQPLGLIGSSTGAGAALVAAGRMPEAIQAVVSRGGRPDLAG
AVLPAVRAPTLLIVGGDDTQVIALNQEALEALRTHKRLEIVPGATHLFEE
PGTLEQAARLARDWFLQHLATAARERPFGEAPP
corcm-h8mfy5: Corallococcus coralloides (strain ATCC 25202 / DSM 2259 / NBRC 10008 / M2) (Myxococcus coralloides) Uncharacterized proteinCorallococcus coralloides Show
MVPVDDAVLVRGRLAVPSGARGVVVLARGSDSSLQSPRLAQTARLFQAMG
LGTLLMDLLTREEMEERRTRQLRFNVGLLGMRMAGAARWLRREGPTAGLN
VGYFGAHTGAGAALSAAAFRPDQVEAVVSRGGRPDLAGAVLPKVQAPTLL
LVGGADTLGLDINRRAYEALRADKRMDIIPGATHHFQEDSELEQVAELAG
EWFLQHLGDPREALEDGAEEAAPP
coreq-e9t408: Rhodococcus equi ATCC 33707 PhosphoribosyltransferaseRhodococcus equi ATCC 33707 Show
MSTEVEFDVDGVRLSGALTDPVDSLPVVVFAHGSGSGRFSPRNRLVAELL
QDAGLGTLLFDLLAPDEEADRHLVFDIPLLACRLLEVTAQLRERTSAVAY
FGASTGAAAALHAAAEKGNDISAVVSRGGRPDLAGSRLSMVRAPTLLLVG
SLDTTVIDLNRQAAKLLECEHELVIVPGATHLFEEPGTLGVVAEHARTWF
VEHGR
cupnh-q0k4r4: Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha) Dienelactone hydrolase or related enzyme, 1 reference(s)Cupriavidus necator Show
MPSNSEAIEVVIPAGGVDLQGILTLPPGAVALVLFAHGTGSSRLSPRNRY
VAAELNRCGMATLLMDLLLPDEDQVQAIRFDVELLATRLAQATSWVARQQ
AVPQRFGYFGASVGGAASIRAACQSSIPIHAVVSRGGRVDLAGPDALAKL
LAPTMLIIGGLDLSVLERNESAYAQLTCTKKLVIVPGASHLFEEPGALES
VARLAAQWFERYLGKDSP
cupnh-q0ka76: Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha) Putative uncharacterized protein h16_A1995, 1 reference(s)Cupriavidus necator Show
MEHITIEQVRIHIGDIALPGDLTLPEAASGLVLFAHGSGSSRYSVRSRGV
AATLNRVGLGTLLFDLLAPDEDAGRSKRFDIALLGERLKAATVTVAHLTR
DRHLRLGYFAASMGAAAAIRAAAEPPPRMRIDAVVARGGRVDLAGHEALR
QLQSPTLMIVGEADPVVLKLNARATAWMQCEKRLEVIPGATHLFEQPGAL
EQVGELAGKWFCQHFAAAGGNL
cupnn-f8gp18: Cupriavidus necator (strain ATCC 43291 / DSM 13513 / N-1) (Ralstonia eutropha) Dienelactone hydrolase, 1 reference(s)Cupriavidus necator Show
MRSNSEAIEVVIPAGGVDLQGILTLPPGAVALVLFAHGTGSSRLSPRNRY
VAAELNRCGMATLLMDLLLPEEDQVQAIRFDVELLATRLAQATSWVARQQ
AVPQRFGYFGASVGGAASIRAACQSPIPIHAVVSRGGRVDLAGPDALAKL
LAPTMLIIGGLDLSVLERNESAYAQLTCTKKLVIVPGASHLFEEPGALES
VARLAAQWFERYLGKDSP
cuppj-q46qp6: Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) (Alcaligenes eutrophus) (Ralstonia eutropha) Putative uncharacterized proteinCupriavidus pinatubonensis Show
MKLVTAQQVMIDADGVVLPGELALPDAPRGIVLFAHGSGSSRHSPRNRLV
ASMLHDADIGTLLFDLLTPEEDIGLTRRFDIALLRDRLSAATESIERLAG
QRDLRVGYFGASTGAAAAVRAAVATPAHRRINAVVSRGGRVDLAGHDALC
RLASPLLMIVGENDPVVVSLNARAAAWIPCEKRLQVIPGATHLFEEPGAL
EQVGKLAAGWFVRHFAAAESKRKT
cuppj-q473a1: Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) (Alcaligenes eutrophus) (Ralstonia eutropha) Putative uncharacterized proteinCupriavidus pinatubonensis Show
MKLVTAQQVMIHADDVVLPGELAMPDAARGFVLFAHGSGSSRHSPRNRLV
ASMLHDADIGTLLFDLLTPEEDIGLRRRFDIALLSDRLSAATESIERLAG
QRDLRLGYFGASTGAAAAVRAAAAAPAHLRIDAVVSRGGRVDLAGHDALC
RLASPLLMIVGEADPVVVNLNARAAAWISCEKRLEVVPGATHLFEEPGAL
EQVGRLAAGWFARHFAAAEAESGT
cuptr-b2ai18: Cupriavidus taiwanensis (strain R1 / LMG 19424) (Ralstonia taiwanensis (strain LMG 19424)) Putative uncharacterized protein, 1 reference(s)Cupriavidus taiwanensis Show
MHGDANITEVTIPAAGVILQGVLALPPGAAALVLFAHGTGSSRHSPRNRY
VAAELNRCGIGTLLMDLLLPDEDQVQAIRFDVALLAERLAHATSWVTQQA
GMPARLGYFGASIGAAAS