Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Duf_1100-S

Duf_1100-S


Genes:Proteins in Duf_1100-S (78)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9acto-q1mx66: Streptomyces sp. NRRL 11266 putative hydrolase or acyltransferaseStreptomyces sp. NRRL 11266 Show
MNDVTELKEFARVHAKALQLPAERYDEVLAGITSDEDGAPGSWTAQWSAM
AGELEDAGELLPAFLCYTLARFPVVDGPARQAAYQKCRSVFDRWRAGQPD
IQRVTASPAGREVVAWAGGLSAAEPKPVLMVAGGIVSLKEQWAPVTLQAA
ALGMAIVVTELPGVGENTLPYDREGWRMLPALLDAVADRADVSDTYALAN
SFGGHLALRWAGHDARVRGIVSSGAPVSGFFGDADWLRGVPGITRHTLAR
LAGAPEGDDDALHKKIADWALTPAELAGLEIPVRYSTSLRDEIIPAGEAA
FLQQHVKDLGLNEIDDVHGAPAHVQQTVDWTFGSLLAMRQGLAPS
9arch-d1jaz1: uncultured archaeon Putative uncharacterized protein, 1 reference(s)uncultured archaeon Show
MNKKQGIGIGIVVVCAIVTVAMFTGCIEEETATPAVTVTPMLTPTPSPTP
TPPLKTVLDKEAVEKTPWMKVVFHDPSFAFQFQRTIGYSYYDGADYEECL
CTACRIKEGDCESWYEEWLKTADRVCEIADKCLAEGHNVSAREAYHRASN
YYRTAEFYLAYRDPSDPSILETWRKSRECFIKAAPLFSPPFEVVEIPYEG
TTLPGYFFRVDDSGTPRPTLILQTGFDGTAEELYFGGCAAAVRRGYNCLA
FEGPGQGRVIREQKLHFRPDWEKVVTPVVDYALTRPEVDPDRIALMGVSL
GGYLAPRAAAYEHRLAACIANGGVFDPFEGLVYPESPEAVKEYIIQDPSA
FDAEMREKAKSNTNLQWAMEQGMWTFGAASPSEWMLKFANYTMKGRADKI
TCPTLVCDGEGDFDFPGQAKKLYDTLTCPKEYMLFTVEDAAEQHCQMGAM
AISHQRIFDWLDKTFAEIGSEQS
9baci-q2azx1: Bacillus weihenstephanensis KBAB4 probable dipeptidyl aminopeptidaseBacillus weihenstephanensis KBAB4 Show
MTQRSQSQGWALDIALALGGFDALHPEAKATMEQLGHDHTDFDKVFSQVK
SGAMIPKAWATVAAQAQERAKHYEQKGFTVTARDLYQRAAVMWGRAQYSY
FNDDPRKLAFRERCNECVAAISSLGGGTVQRIVLEFEGKQIYALLHLPSG
EIRNAPAVILGPGMDMIKEDYIQIAQRYYTSRGIVALSIEGPGQGESVSG
GLKVDLANYERAVSCYIDFLSKRPEVDPNRIGFFGISMSGYWGMRAAASD
NRINAIATFEGVYGEFDTIFNRAQPSFKANFMYMSGYTDEVAFENELSSQ
MNLWKLAPKITCPVFMGIGEFDELTRLEEALSLYELVEAPKELRVYENEF
HPLGGVAAEIFRFGAEWVELALEGNFKNDYDERYYMHRDGGVTEGTAFPT
YWLGAQPAEIKARKKCNTLNACKS
9chlr-d6tbj6: Ktedonobacter racemifer DSM 44963 BAAT/Acyl-CoA thioester hydrolaseKtedonobacter racemifer DSM 44963 Show
MERDARVQSAITNWAPRFVANGIDVNDFTRVTNSIERWDAWCQTWADCGA
IHEQLGADAETRGYYETAGEHYFRAAMCYHFGKYLFVQDTRQLRNAHEHV
VRDYQHALPYFLFPGERVSIPYEGGATMYGILRKPWYAPHPPVVILVPGL
DSVKEELHVYGEDFLRRGMAVLAIDGPGQGEMEFEHAMRHDYEVPIRYAI
DYLERRPDVDARRVGLMGVSFGGHYVVRAAAFEKRVKATIENCGAYNQLE
NFRGRPQLSRDAMVFRLKAASEEEAVKRLEQFSLQGVAERVQCPLLAIQG
GQDGLVSPEHGKRIAAEAGANAELWFFADGNHVCNNIPYKHRPQQADWMR
KQLS
9clot-a8rn00: Clostridium bolteae ATCC BAA-613 Putative uncharacterized proteinClostridium bolteae ATCC BAA-613 Show
MSKYRQNESWISNKFVGQLGIEAFMPNANMGLEEKGFKHADIQRANRRMT
CLRAMPKAWKAVAEQQEKLAEESAAMGNMVTAGAFYHRAALYYGKAQLYH
HKDDAMKLELHTSCVRCYEKAIAGYDYTIERVVLPFEGKNIYGIFHAPKG
ALNLPTVLFTPGMDMIKEDYPNLNDNFFVRRNMCVLVMDGPGFGETRVHG
LPVTLTNYPEAASLFLDWLCGRPEVNPDQIGIFGGSMGSYYGPTVAVNDS
RIKAVVGLLGCYLEKDLQFNSCQPGLRNNFKYMCNIYDDDAFDEFVAEMT
LEKVVDRLKVPFLMSTGEFDEMCPPELTERFFHMLDCPKEMWIMEGEFHS
CAGMYHELFAWAIDWLREALTTGKPENLEVRKVIPERW
9clot-c6pte9: Clostridium carboxidivorans P7 Putative uncharacterized protein, 1 reference(s)Clostridium carboxidivorans P7 Show
MKEFFKDSQFSFQTLRLLGETAWGAADIGEVLETIERIKDGDLESWCIEW
TKTAERMDKFAQECYLDGNLISAAEGYLRASNYYRTAEFYLHENLEDKRI
LELYDKSLECFSFVMKLNNPVIEGIRIPYEGTSIPAHFYKVDGNVPRPTI
IAITGFDGTKEEMYGLGMAAVKRGINCIAIEGPGQGEVVRKQNLFFRPDY
EKVITPVVDYLISRKEVDSKNIILLGESFGGYLVERAAAFEHRIAACIAN
TGVFDFTASKTSPDLPKEELIKEITKNIDEVNMELRKSMEISNEMRWAFS
HGMYVFGVKTPAEWLLKAQEYCIDGVYDKIKCPTLIIDCENEDLLKGQPK
KIYDLLTCPKEFMMFKAEEGAGAHCEVGGKLISNQRIFNWIQKIIIANTN
S
9firm-d2kfp1: Cellulosilyticum ruminicola Esterase, 1 reference(s)Cellulosilyticum ruminicola Show
MAWSLKDMMQPVIARLFIYGMNPIELEHVFKTLEEVPLLNVLTLEQKWVE
LWETRAQKFRKRAEEAEEKGNLRSAKTFRKYVVQFDYAQFLINSNEIDFK
KAIYERFERDYEKYTKYLSGKVEKVAIPFKEDKKLVGYLHLPKVVKEKYP
CMILFPGEGSCKEELNTLAREFAARGIVALAWDGPGTGNSLFKESIKTGF
DNLEQSFKTVFEWLKNIAYIDAARIGCCGLCMGGGYAYFASAHNTEIKCC
INLFPLFMTQVDDTKIPRWMINSKWTNYQRDLEYAALMNEMKALEEGAVA
CSYLLVESMYENWMPQEAVTKLYDKAKGHKEMIRVEEEPVFSNGETRLHT
MPVGEQMHWLKHAIADWAVEQFK
9laco-c2ent8: Lactobacillus ultunensis DSM 16047 Dipeptidyl aminopeptidase/acylaminoacyl peptidaseLactobacillus ultunensis DSM 16047 Show
MTTTFKKHWSDYKYNDNMLQDALIKHVMDLMPYRMSDEGEVLEVIMNIKE
SDEQSWISAWSNMAAHLQNRAHHFEKDGKKISASSSYLRASTYWRVALMY
FGDWEDPRMKDYSQRSQDCYDRSLELSGYPGEAIKIPYENTYLPGHFYRS
PYVKDEKAPLLIVVPGRDTWADDTIWVTDAAIKRGINALTFDGPGQGMAL
RLQNLKFRPDFENVLGPVIDFAQGLDEVDDNRIGAMGMSFGGFLVPRAVA
FDNRLKFIISDPGNMNWGGMIAGRLEKALKMPAIIRPKMIDFVLKDYEWK
HGATDKTIINELQKYNNTDIVDNIKTKTLVLDGSAEVTHGAAKKFYDALS
CPKDYMLFDENSTAQQHTQMGGYATGTEYIMNWIEDNI
9laco-c8p8a9: Lactobacillus antri DSM 16041 Putative uncharacterized proteinLactobacillus antri DSM 16041 Show
MTVSNGGFNKHWPEMKFSKNMLQDALIKHVLGLTNYHMADIGEVFEVTVN
LKHGNEENWINSWSTMADRLQKKAQDYETKDKKISAASAYLRASTYWRVS
LMYFSKTEDVRMKDYCLASQNCYDKALKLSDYPGTAIQIPYEDTTLPGHY
FTAPSAGQDAPLLIVVPGRDTWADDTRWVTDAAIKRGINALTFDGPGQGM
TMRLQGLPFRPDFEKVMKPVLDFATSLPHVDNNRIGVMGMSFGGFQIPRA
AAFDKRIKICITDPGNIAWGKVISQRLKKILSLPRSLRPALLEYLLKDYT
WKQGCSEENLLNELAKYDNTQIINKISAKTLVLNGAAEVNPTAAKEFYDL
LTCPKDYLFFDENSTAQQHTQMGGYAPASEEIFNWISDNL
9rhob-a3vdm3: Maritimibacter alkaliphilus HTCC2654 Putative uncharacterized protein, 1 reference(s)Maritimibacter alkaliphilus HTCC2654 Show
MEESDMAEMSGPRSLENAKEWMLGKLDARVHPFALTDVDQTRVVIEGLQG
LDGESWAAAWAGQGDAYAEKANAAEAAGDTDSARDNWYQAYGYYFLGRFP
CPNHPDKLASYEKEVAAYQSFGKYAQPAIEVVTVPFDGREGEGEEITFYV
RMPEGIDNPPVIVMWGGVDAWKEEMTILTEGLAARGFATVALDNVGTGQS
PIKAGPDGERQFMPVFDWVESCGKFDARRIAIVGRSFGGHWATKLAHLMP
ERFRAAVNWGGGVHYMFQPDWIEKSRHPDSYLMELVETRSRMLGATNDEE
YIQGFKVLSLLEQGLLDQPCAPLLLINGKNDTQCPITDIELLTEHGDPKS
VRLFPGRGHMGFGPGTVDAIIDWLKARLA
acice-q2e207: Acidothermus cellulolyticus 11B dipeptidyl aminopeptidases/acylaminoacyl-peptidases-likeAcidothermus cellulolyticus 11B Show
MVDERVRIAIENWGPRFTTNGVTYSDFHEVLSRITTWEEWCSAWCTAAEP
YVELGRAALDEGRTLSAGDHFSQAAVYYHFAKFLFVDDMEQMRAAHQKAV
ECLTTALPYLDPPGRRITVPFEGARMVGILRLPRGEPPFPAVMLIPGLDS
TKEEFRSTEQLFLQRGLATFSVDGPGQGEAEYDLPIRPDWEVPGAALLDA
LASQPEIDPARLGIWGVSLGGYYAPRLASGDQRVKACIALAGPWNFGACW
DGLNELTRAAFRVRSRSRSDEEARAKAAQLTLDGRAERIRCPLLVVAGKR
DRLIPWQDAVRLAEAAGSQAELLLLENGNHGGMNVAAQHRQRSADWMARI
LGGRVAG
acrsp-ucsc: Acremonium sp. UCS1025A pyrrolizidinone biosynthesis cluster protein C, 1 reference(s)Acremonium sp. Show
MYPFFTYSPGRHYFEYKWYNLELLRLIGSAPYGGCDAAEFLELVASLKPN
DADEWHHKFLALAERTQAKGEQMSEAGHEAVARGAYLRASNYFRCAQYMF
PIMPAARQGEFLKLYHRSIRSFEQAAELMEHRVERVSIPFQPPEYRAPAV
ELPGWLHLPAAHQRLSGRKTPLLICVGGADSTQEELYFLSAAEGPGLGYA
ILTFDGPGQGLTLRESGVPLRPDGEVVIEAVLDFIESYAAEHPEADLDVD
AISITGQSLGGYLALRGAADPRIKACVAVDPIYDFYDLAMSRMPRWFMWP
WERNYMGDGFVDFAVIEHSKLDVATKYTFAQGGQMFGSASPAQMIRDMKQ
YTFRLDKTITASKRHGNNRDYLEWVTCPVFVTGAAGDEKLFLPEMSTSAI
MRNLANVPDEHKELWIPKEWSEGGAQAKSGAWPLLQHRCFKFLDEKLGIS
R
artni-Q93NG6: Arthrobacter nicotinovorans 2,6-dihydropseudooxynicotine hydrolase DHPON hydrolase, 8 reference(s), 1 structure(s).e.g. 2JBWArthrobacter nicotinovorans Show
MTVTSQVKPEDEMLNWGRLILDGVSYSDMVGARDRPKEITWFDYWMSLAN
EYEQEAERKVALGHDLSAGELLMSAALCAQYAQFLWFDERRQKGQARKVE
LYQKAAPLLSPPAERHELVVDGIPMPVYVRIPEGPGPHPAVIMLGGLEST
KEESFQMENLVLDRGMATATFDGPGQGEMFEYKRIAGDYEKYTSAVVDLL
TKLEAIRNDAIGVLGRSLGGNYALKSAACEPRLAACISWGGFSDLDYWDL
ETPLTKESWKYVSKVDTLEEARLHVHAALETRDVLSQIACPTYILHGVHD
EVPLSFVDTVLELVPAEHLNLVVEKDGDHCCHNLGIRPRLEMADWLYDVL
VAGKKVAPTMKGWPLNG
aspa1-acrc: Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094). Acurin A biosynthesis cluster protein C, 2 reference(s)Aspergillus aculeatus Show
MFKFYPSDFFHFEFLRVLASAPAGGAETGECLAVLPQVPDGDAEAWYRAW
TAQAQQARGLGDEALVSGDTVAASGAYLRASNYFRASEFFLHTRPDDPRL
LAAMENSVAVFDKGVDLLDTCTVVRVEIPYEEEKGAARLPGRLYLPRSGA
AQTGQGQSEDKLPLLIMTGGFDSTQEELYFFGPAAALPRGYAVLTFEGPG
QGICLRRDGLRLRPDWEHVTTKVLDVVESQLAKDYPIDLERVAVVGASLG
GYFALRAAADPRVRACVSCDACYDLFDVTRSRMPGWFINGWLSRRLSDGF
FNWVVNKLAGWSFQLRWEFGHSMWVYGVESPAEVMRCMQQYHARGYLQKV
KCSTFVTGAADTFYFTPKQNTEPIFEALGHVPLQKKRLWIGKGVEGGGLQ
AKIGAWAVFHQKMFVWLDEQFEIKRGTI
aspcl-CCSE: Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) Hydrolyase ccsE, 4 reference(s)Aspergillus clavatus Show
MHKLFKNAPFFDFEAIRILGTTCYGGADVAEVFEAVDQIKNNDPETWETA
WRIQAERAEKLAAEALEHGDRDAALAGYLRASNYTRASGYMYVSRAESSG
EALVQDARALPIAEKVGELFRKAIPLMKGSVHTLGIPYEEYALPGYLYLP
PPWRRIPGRKIPILVNSGGADSCQEELFYLNPAAGPGQGYAVVTFDGPGQ
GIMLRKYGLEMRPDWEAVTGRVIDFLEEYAAENPHLELDLNCIAVSGASM
GGYYALRAAADQRVKACVSIDPFYDMWDFGTAHVSPIFIHAWTSGWISGG
FVDNLMALLSRLSFQLRWEISVTGTFFGLSSPSQILLHMKKYTLRSTEEE
PEGFLSRVICPVLLSGAGKSLYLDVDNHTRQCYDGLVNVAERNKQLWIPE
SEGQGSLQAKMGAFRLCNQRTYRFLDECFGIMRKSL
aspfu-AYG1: Aspergillus fumigatus (Sartorya fumigata) yellowish-green 1.Heptaketide hydrolyase ayg1, 12 reference(s)Aspergillus fumigatus Show
MPRWILGDKFDTVFPHKGSLKVLWESRWKFACSKSVYPFHDGSIEDFEPI
FNHLISKNINDAASDEYTQAFLPTASALEEKAAQALQAGKHEEASNLLCR
AAVVYRISRFPYVDITKPNSIKRVAFERQKQAYLKATSLWTQPIREVTVP
HTYRTGNDGAHIPIYIRTPAGADQSNPVPIVLIMTGLDGYRPDNSQRTHE
ILARGWAAVVAEIPGTADCPADPADPASPDRLWDSVLSYLDQRPELNTAK
MVVWGLSAGGYYAIRAAHTHRDRLLGAIAHGPGCHYYLDPEWLAKVNDHE
YPFEITAAWATKHGYKTVEEFVAGAQKKFSLVETGIVDQPSCRLLLLNGV
DDGVVPIEDCLVLFEHGSPKEGRFYKGLPHMGYPNSLPVSYEWLEQVLAS
PSKTKN
aspfu-psoB: Neosartorya fumigata (Aspergillus fumigatus) Alpha/beta hydrolase psoB, 5 reference(s)Aspergillus fumigatus Af293 Show
MATIHKLFKSPFFDFEFLRLLAMAPYEGAEIGEVLEAAAKIKDQDPESWY
STLLETGGKAEAIAKQAEASGDRVGARRAYLRSSNYLRAAQFMLNEGPIG
HDERVLPTLERAIANFRKGVQYRDGKTIFLEIPYEGGKTLPGYLYLPPAA
RRIPGRKIPILLNSGGGDSTQEEIYFVNPAYGPDLGYAVLTFEGPGQGIV
LRRDKLPMRPDWESVTGPVLDHLFDLATRHPELELDLDHIAVTGASMGGY
FALRAAADPRIKACVSVDGFYSLSSFVGGRMPGPLFNGFMSGWLSDWMFN
GILGVLKKLAFQARWEFNHLRWATGSTTDADVMRSFGAYTLQKADGTEYL
ADVKCPTLVTGAGASFYFDPATTTDKIYDCLTSLQDGVDKEKWIATDVAY
GGLQAKIGAFGYSAQKTFEWLDQRFGIQREPLAASSRLEDLVSRL
aspfv-ffse: Aspergillus flavipes. Cytochalasans biosynthesis cluster protein ffsE, 1 reference(s)Aspergillus flavipes Show
MTGPPGNPAFATIHEFFPGNTFYNFECLRILSTAPYGGCDPAEFLTAIAA
IKPSDPETWATAWSHAASQAERIAEDALARGDTLAARDAFLRASSYTRAS
GYMRINGPTLDRHDPRALPVARKTQALFRKALPFLDCDARIVDIPYRPTQ
YSKPVSLPGYVYIPSPQNRLPDGKIPVLLNTGGADSVQEELYYIHPQAGH
ARGYAVITFEGPGQGIVLREKGLYMRPDWEVVTGQVLDWLEGYAATLQQE
EGLTLDLSRIAVVGASMGGYYALRAASDPRIKACLSIDPFYDMWDFGTRH
ISGLFMAAWTGGWVSDATIDRVIGAGMYLNFQLRWEVGVTTAFWGIESPS
RILREMKRYSLQGGFLARVQCPVFVSGAGKSLYFDTEEHTMRVFGDLKHL
GERRRTLWMPSRPEEGGLQAKIGAFGLVNTKAFGFLDGVFGVKRVLEAET
aspnc-a2r3s8: Aspergillus niger (strain CBS 513.88 / FGSC A1513) Function: ayg1 of A. fumigatus has an unknown function, 1 reference(s)Aspergillus niger Show
MAPWILGEKFNTVYPHKGSIKALWETKWKFACEKSVYPFHDGAIEDFRPI
FQKLIDENINDAYTDAYTQAFFPVAEALENKASAALNNNNVEMASDLLRR
AAVVYRISRFPYVDPTREDIKKEAFNRQKKVYLKAASFWKPTIQEVIIPH
KHKSATDGAYVPLFVRVPEHATAENPVPVVVLMTGLDGYRPDNSQRTHEI
INRGWATVICEIPGTADSPADPSDPESADRQWTTVLDYMATRPEFDMSRV
AAWGLSAGGFYAIRAAHTHRDRFVGTLAHGPGCHYFLDPEWLSRVDDHEY
PFLLTPAWAKKYGYSNPEDFKKHGQKKFSLLETGILDQPSCRLLLLNGVD
DGVTPIEDCLMLFNHGSPKEGRFFHGLPHMGYPHSLVPSYKWFEDVLRSP
QEPLKN
aspor-q2uab6: Aspergillus oryzae; Aspergillus flavus predicted hydrolases or acyltransferases, 1 reference(s)Aspergillus oryzae Show
MRLRSSLCIGALFTLATASRSIPNVTITNSTTSTYQLSSDSEFAFVLETF
LSFANGGGAATGEILRAASQIKPGDMESFYREFKYLADQIADQAMSVNTT
RFPVSAREAHLRASSYYRAADFFLHGNASDPRIQTLWDSVLDHYDTAMKL
LPDPPEQVELDGTEYKIPIYFHPPPKSSHANATSGQRKRLPTILIGSGYD
GAQQDTYHQLGKEILARGWNFVTYEGPGQPTVRRQSNIGFIPDWWSVVTP
VVDWLRTRDDVDTDRIALGGISFGGQLAPLAATREHRLAAVLAIDGMLDL
HETVLQQFPASIQKLYQSGNKTAFDAIVWEAYKETTDTSQIWGIDQGLWS
FKTSSPFEWMTKMKKMAIDQTMLDNITCPVFVASGQDDHIAPGQPERMAR
LLGDKAYYHLFKNNVGAGEHCTIGAEPQLAMATMDWLDEIFENPTSRS
aspor-q2usq8: Aspergillus oryzae predicted protein, 1 reference(s)Aspergillus oryzae Show
MPNWILGNKFDTIYPHKGSIKTLWETRWKFACQKGVYPFHDGSFEDFEPI
FQKLISENINDASTDEYTSTFFPIASDLESQASQALDSGKPDDAIDLFRR
AAVVYRISRFPYVDITQPNSIKRAAFERQKQVYLKAASRWDPPIKEVIIP
HSSRGRNDGQEIPIYTRIPRTARPDNPVPVVFIMTGLDGYRPDNSQRTHK
IIGRGWAVVIAEIPGTADSPADPADPSSPDRLWDSVFAYMATQPMLDMSQ
VVLWGLSAGGFYAIRAAHTHASRLRGAIAHGAGCHYFLDKEWLSRVDDHE
YPFSCVETFVLRRFKGHALIICRIMPGWTKKYGYDDTEVFVQEARKKFSL
VETGIVDRPSCRLLLLNGVADGITPIEDSLLLFNHGSPKEGRFFEGLPHM
GYPDSLPVAYRWLEDLLPCEPKQKN
bacha-BH1839: Bacillus halodurans hypothetical protein bh1839, 1 reference(s)Bacillus halodurans Show
MIALKELKQYADLHVKTHSFQVINPRQVLQSIERAASEEPTAGGWDWQWV
DAANKCLQANAIEDAIQCYNFARFPFPKTSLQQEAADRLTKVFEQAYCRE
DVQKHRVYYDNQKVTVYAANLHPDLPCLLVLGGIVSIKEQWSVFLQVGKR
LGFSVLITECPGVGENQVRYHADSYRMIGQILDTFAGQAKVGDTYIVGMS
FGGHLAMKQALHDERIKGITTVGAPLHYFFQDYSQLNVPFITQATLAHVM
EEELDHVGRALSRFAFMPKELNKLKIPITYIFSSKDEIIPKSEKSFLLDN
IANLTFYEFDDVHGSPNHLPLIQKIIPLSILKHSNSKRYFVRIMLAFLLT
YNKWKGRDGKR
bactu-c3ice0: Bacillus thuringiensis, Bacillus weihenstephanensis, Bacillus cereus Putative uncharacterized protein, 1 reference(s)Bacillus thuringiensis IBL 200 Show
MIIMTQRSQSQGWALDIALALGGFDALHPEAKATMEQLGHDHTDFDKVFS
QVKSGAMIPKAWATVASQAQERAKHYEQKGFTVTARDLYQRAAVMWGRAQ
YSYFNDDPRKLAFRERCNECVAAISSLGGGTVQRIVLEFEGKQIYALLHL
PSGEVYNAPAVILGPGMDMIKEDYIQIAQRYYTSRGIVALSIEGPGQGES
VSEGLKVDLTNYERAVSCYIDFLLKRPEVDPKRIGFFGISMSGYWGMRAA
ASDNRINAIATFEGVYGEFDTIFNRAQPSFKANFMYMSGYTDEVAFENEL
SSQMNLWKLAPKITCPVFMGIGEFDELTRLEEALSLYEFVEAPKEIRVYE
NEFHPLGGVAAEIFRFGAEWVELALEGNFKANHDERYYMHRDGGVTEGTA
FPTYWLGAQPAEIKGRKKCNTLNACNN
braja-BLL4985: Bradyrhizobium japonicum (strain USDA 110) bll4985 protein, 1 reference(s)Bradyrhizobium japonicum Show
MIPACLSDDWSLCPEREDISAEFTRLLTAAQEGGATIAECLMIARQLKRG
DEQSWHREWKRLAQANRHRAGAAFAEGHMATAQRNWLRALNYYGAAAMPL
DQADERRWVAVLAMQECARRYLTARAPAGEVVTIPWVDDHALQGYFLPAA
SAGGRAPTVICIGEPGHRKEEFLFKLAPHARERGLSMLALDLLGDQRDDY
TDTLLQRRDLESSIASVMDYLETRGDVDFDRVAIVADGWGSSFVARAVLQ
EPRLAAAVCDGGLWDLHERSFFASRFAMSDLSIVPVPHAPLMASSADCPV
LITLGEDGWLKADRARQIVQKSRLGSSDIVLKVFTAAETGAAQAHADNPS
LANEYIFDWLESRLGAAGRRS
braja-BLL6428: Bradyrhizobium japonicum bll6428 protein, 1 reference(s)Bradyrhizobium japonicum Show
MSRSMFRYFPTNYVWNLSVDLAIEMGARIGEIEEMCAPLQEAARQPDAAG
TAAFRETWSRMADKLCDLAAEDEARGRLLSAGEKYGRAATYLITCERLQA
HGASGRLELYRRFLDVFAKGVTLAKENCARVEIPYEGAHIAGLFVQAEGV
EGPAPLLVQVNGLDSTKEMKYRVGLPAWLARRGVSSLVIDQPGSGEALRL
HGMTARYDSEHWASRVVDWLETRADVDPKRIGLEGVSLGGYFCPRAVAFE
PRFACGVAWGANHDWRDVQKKRLQKEGSFPVPHYWAHVRWVWGAKDQDDF
VAIAENVHLDGILDRIRVPFLVTHGEKDSQIPLHWAERTYEHLVNSPKRE
LKVVTDREGGAQHASFDNSINAGQYIADWVAETISGRTS
braja-BLL6890: Bradyrhizobium japonicum bll6890 protein, 1 reference(s)Bradyrhizobium japonicum Show
MEGDHWPHGRCDGAGGSLVRLRKRASEFFESLSVAELAREAHRHLWFSDW
LRVAEDYRSSAESARADGAGRIVACEAWICALMAFEVARSLSSPDDLAST
DFADRVGLSLRSFADDAAHAIEHVEIDDFEQGALTGFFLPALCHGPSAPA
VICIADEDVTLASMMSRLLPASLRRNMSLLLIDPGSSPVRRPLKQEHILQ
CWLDYLEARPDVDAQRIAIYGEGTGASHASRLVLSDRRVAAAVCDGGLLR
SVAHRASVHWMTGVEQVVEGGASMRPLSSPRRMACPLLMVVGSRSMVREQ
EALELQAGYRQAGADCSIVVPNRIPYPLGEVENFITVDDFIFEWLDAKLG
AARRLDPVTYL
burs3-q397l9: Burkholderia lata hypothetical proteinBurkholderia sp. Show
MSLQDDRMNGAYRAEGWVQWPGEPELSFQFARTLGGAQEGASLISECFRA
ASRMTPGDTESWYREWQVLAKVSEQRALDAHERGFLRTASSNWLRAANYY
RSSEFYLAHDDARRCDSFDSVERCSHRYLEGLTPAGEVVRIPYEGGAHLD
AYFIPCAGGDVRSPAVIAFGGLDEYKDELLHEMPKHALTRGMSLLLVDLP
GQGGTLRRQGIVNRPDTEVPVGACVDYLLTRGDVDHGRIALYGASVGGVY
AARAASFEKRIVAVVSDSVMFDMASLFASWLDTPERLIWRHLKWVFGCAT
PQEVVDKARDFRLQGVIDRIPVPYLVLQGTEDWLGLKTATDTYDYAKAHG
VDATLRLFDPDETGAAHCQVDNPTLGQEFICDWLAARLGIDQRAVRQRRP
ALA
chagb-q2h3x4: Chaetomium globosum CBS 148.51 hypothetical proteinChaetomium globosum CBS 148.51 Show
MSPHASQGATTSGGEGKTPSHWAMGNKAFEHRMPHHDGIEALWETRWKLP
CTKSLYPFHDGAYEDFAPIFDELIRNNINDASSPDYTNAFRSTAEGLIGQ
ADLGAAIGTKTAEVINLYLRACAVCRIARFPYITSFPQVNDSVKWEMWEM
QKKTYLKAGALWLNPVEEVVVKHRYAEGRDRGEIPVYVRTPKMVHIDGEE
KEGTAFPTVVLMTGLDGYRPDNTLRCEEFLKRGWCVVVVEIPGTADCPAD
SADPQSPDRLWTSLLEWMSGDGRFDMKRVLVWGLSSGGYYAIRIAHTHKE
QLVGCVAQGAGCHYFYDQKWLEKVDGHEYPFELSPAMAMKHGFKSVEEYR
TKAQKKFSLLETGIIQKPSTRLLLVNGTLDGLMPIEDSRMLFEYGTPKEA
RFFPGALHMGYPMANGAVYPWMEEVMQSVKD
chrvo-q7nzq6: Chromobacterium violaceum probable dipeptidyl aminopeptidase, 1 reference(s)Chromobacterium violaceum Show
MSRSEAQSWSLDIALAQGGFDALHPEGKNTLLQLGHDPADFDAVFEQVKS
GAMLPKAWAEVAARAERRAAHYERDGYRRTATDLYLRAAVMWGRAQYSIF
DTADPRKAVLRARCNHCVARIGELRDGRVRRVEIPFEGGLIHALLHLPDG
EIRQAPAVILGPGMDMIKEDYLYAAERYYTSRGMVALSIEGPGQGESRAG
GLAVTLDNYERALEAYAGYLAGLPEVDAGRIGMFGISMSGYWGMRAAAGD
TRLAALAAYEPVCGDFLTIFERAQPSFKKNYMYMSGYRDEALFDREMRDR
MPLDALAADIRIPVLLGIGEFDELTPLEQALACYRRIRAPKEMRVYENEF
HPLGGVAAEVFRYGAEWLERALSGDPALREPGRDVRHYLRRDGHIGDGSA
APDWWQGADPTAE
cloac-CAC3402: Clostridium acetobutylicum Dipeptidyl aminopeptidase/acylaminoacyl-peptidase related protein, 1 reference(s)Clostridium acetobutylicum Show
MKNLIFKDSQFEFQTLRVLGSSASGAADIGEVVETAQRIKEGDFKSWCDE
WSKTAKSLEESAEESYSKGHFISAKKAYLRAANYYRTAEFYLHENPNNPI
IGELYEKSLRCFSYVMKLNKPAIEAVKIPYENTFLPAHYYKLQNSNGKAP
VLIAMTGYDGTKEEFYGLAMTALEHGMNFLTFEGPGQGEAVRKQKLFFRY
DYEKVVTPVIDYVISRKEVDQAKIILWGESLGGYLAPRAAAFEHRLAACV
ANSGVYDFFGGILRELGNNSREEFFSAARINPEEFDKNIYSIAKLNSKVR
WGIYHGMYVFGVNSPHEYILKAEDFYLKDIAEKIKCPTLVIDSDNDGILG
GQSKPLYDVLRCKKEYMFFTSENGAGYHCQVGAKLIGWERILSWIEDIIK
cloac-CAC3515: Clostridium acetobutylicum alpha/beta superfamily hydrolase (possible peptidase), 1 reference(s)Clostridium acetobutylicum Show
MSIEFSRWPNNYMMSYQVTKALGLASLGATDVTEIYEACKKIDPNDKETW
HREWLITAETLERHGKEAEAVGNWYTARNCYIRACNYNRIAEYTVMDDDN
EKIRIFRKVNELFEAAGKYFDVKPEKIQVDYEDVKLDGYFFSPSWIKGPK
PTILALNGGDEWSIENYFWLGPAFISCGYNFMVYDQPGTGLSMYEKGKGR
RADSEAFHSRAIDFLLTRPEVDPNKIIVHGESFAAYDSLRFASFDHRIAA
VISDGGTHAFDWEAMLKWMPPSLAGHGMRILGAKSLDDFAENPRFAYNLE
GVLHQIECPLLVMHGAEEILVQPNPLTQALKNYEQAGSKNKTFFPIEDRR
IGGLEHCQVDNINVLHEVVLNWLCSIGLGPFAPRPSDC
cocps-e9dbi4: Coccidioides posadasii (strains RMSCC 757 / Silveira; C735) (Valley fever fungus) Putative uncharacterized protein, 1 reference(s)Coccidioides posadasii Show
MFSFFRSRFFDFELIRILGSTPFGGCDIAEFLEAIDKIKKHDAESWYRAW
YEQGERVEKIAQDATRDGHKAPARRAYLRACNYFRASSYMLPTSDGRSLP
SAERSIRNFRKAIPLMDETIVVLDIPYEDGLTLPGYLYLPAPSKRIPGQK
TPILLNCGGADSTQEELYFLYGAAGTDLGYAVLTFEGPGQGLVLKKDQVP
MRPDYEVVTSKVLDHLSSIAKANPDYFLDLENIAVAGASMGAYYSLRAST
DSRIRACVAVDPFYSLWSLALTRMPSLYANLWQAGWIPESFFNWSVRLSM
AFDFCSRWESSLGSYMMGTSTPGQTLRRFQAFTLDDPVNGGKVTDRAKCP
ILLTGAGHAIYASPDSSTVYIYNSLKHLEKTQKEVWIPTEIGDGGLTAKV
GAWGLLAQKSFQFLDKHLGVRRAGLSSYRLEVEV
colgm-e3qun0: Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) (Maize anthracnose fungus) (Glomerella graminicola) Alpha/beta hydrolaseColletotrichum graminicola Show
MDILPWEFFNFEFIRVLSMAPTHGADVGECLEAASKIKKNDPEIWYQAWA
EAADLAEEAADTALKLGDREAARWAFLRACNYRRASEYMLHVNPYDTRLL
GIMEKSVSNFRSACDLFDNTVETFEIPYENTKLPGYMYLPTPKSGGKPRG
EKVPLLLAMNGFDSTQEELYFFIASGSASRGYAVMTFDGPGQGIVLRRPG
QPPIRRDWEVVVSAVLDSLWKLVDEHPEWNIDLDRIGIMGMAMGAYFALR
GATDPRIKACISCDGFYDFGPQVRLRSPFFLKYLTDGQADAILEWASGFN
MQHKLEFGHLRMVFGTKSCIDALRKLGSISLEAPGEKPICAKVKCPVMVM
GARDTIYTLETHLTYQKLAEYRGSEEGLTLWDPVGPGQGSLQAKVGAVSR
LQMKVFSWLDEVFGIQRPPIAKQPI
conwi-d3f4h1: Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) Putative uncharacterized proteinConexibacter woesei Show
MFQYFSTNYWWSLMAMGALQTGGEISEIDEICRPLETLSRRGVEDHGANE
EWFAAWTKMGHRLERLAKADAEAGFPLGAARKHYRAALYFSVGEFALDAR
VVARGREAYVRGLENFRRAVELSGDPVELVEIPYEDTTLDALFIRAEGDG
PAPCVIHFGGADSVKEHLYLRYKNEFSKRGVSLLIVDHPGVGTAIRLKGL
PTRADIEVAGTASADYLATRSDVDMERLGICAMSQGGYYAPRIAALEKRM
KLCVVWGAIWDMETIVNEYNSITRGKLKPKQHRTFGGLEPEEVMERIKQM
TLEGLADKIECPILVIHGENDQQAPLWRARKTCDEAINAPRRDLKVFTVE
DGGAEHCQVDIMTMATDYIVDWTAQRFREMEAA
cuppj-q46mv6: Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) (Alcaligenes eutrophus) (Ralstonia eutropha) acetyl xylan esteraseRalstonia eutropha Show
MDAMRKGQRWVLDAFLAVGGLDVLHPDAGAIFEQIGYDSTDLKRVFGPVK
AGSMLPSAWSGAAKEIEHRAQHWEERGFTRTARRLYERATLLYARTHYSI
LGDDPRRGRYLEKVIESFKKVIAFSDHPIERVVLPFEGHHLHGILETPPN
AKKLPCVIMLPGMDMFKEDWHKLMEQRILPRGWAAFALDGPGQGESLTKG
LKMSLDNYDRAITAVIDWLSAHPAIDPERIVIMGSSMGSWWATRAAAVEP
RIRAIAANMSNLGDKFVLLNQAQPSFMANLMYMTGITDTEEIQALSKAMT
LDDIAPKVSIPYLIITGENDELTTLDSSIGVYGKLRGPKELWIYQYEFHP
IGPQSDEWLTASLDWLEHALEDCFAPKHELRTFITKQGEYLEGSGEPPWW
HP
desao-e6vtg3: Desulfovibrio aespoeensis (strain ATCC 700646 / DSM 10631 / Aspo-2) Putative uncharacterized proteinDesulfovibrio aespoeensis Show
MKNYVSFLVSFAVLLLPLSNVHAEDGNAFDAHATTFSYFFNDSDMDFHFG
NIILGAVTNGGAEVGEAFYAASRIKDGDTASWHSEWYALAKRVEARGDKA
LKAGHRVSAREQLLRAAYYYRISLMAMPGDNPELEKRGKKCRSLMKQAGQ
LFDPPLEYFEVPFEDTVLPGFFRKADNSGKPAKTLLMIGGGETYIEDLFF
YIARQSHDRGYNFMTIDLPGQGMLPHYGHVFRTDTNVPMKAVVDYALSRP
DVDPAMLAAYGISGGGLFVPQAAMHDPRIKAIAMSSGVVDAYALFATMPA
AFATEKDMKSWTPFHAAVVDAICWRYGVDKPSQLIEANRGNTFDSTKIHV
PALLLMGEGEYRSKEVQRQQKIALDGFTDSRSKMVITPSDEGATNHCLME
NRSLVGAVLFDWLDEVLK
desps-q6akv7: Desulfotalea psychrophila hypothetical protein, 1 reference(s)Desulfotalea psychrophila Show
MKVIIICTLFISLINTPLLPLLRISAAEERGLSQMKSAQKEVYDAHRSYT
RFHFTDNEMDFAFQWLLGSIVNGGAEIGEAFYVAAHIEDGNPKSWQDEWE
RMALRKELRARRALDAGHLITARQCLLKASNYYRTALVSRSVSDGKFNTI
SKKVRSCMQAAAPLFSPAMIYFEVPFAGTVLPGYYRPVQQNGTARKTLLM
IGGGETFVEDNIFYIEPQAILRGYNFVTVDIPGQGMLPSEGLFFKKDTEI
EMKAILDVILDFAEIDPERLAVYGISNGGYFVPRAATLEKRIKAIVVSSA
VVDNYLMFKEMPFSKESQEQIDSWPAFKKAVTSGVTWRWGLEPENIKGQT
EQTRGFQFNPALITCPVLDLVGAGEYVNRETERQQQEFMAKLGSKNKTLI
VTPEDEGASSHCIGENRSLMAELVFDWLDELWPE
dicd5-d2c1r0: Dickeya dadantii (strain Ech586) Putative uncharacterized proteinDickeya dadantii Show
MMLDELKNFVLLHSYVLNVGAETRAILPDIHHLGDDAPHSWSQMFYYQAQ
QYEKQGEWLKACSLYNLARFPYPETPLQHECNQHCQRLFHQQYIESGAVT
RVSLSQGRQVCYVRKKNTNNVIIINGGIISLKEQWVNLVGLFERFDVTVV
LTEMPGVGENQLPYNEQSFRMYSDVLDYLAQDRADIRCHIFGLSFSGFIA
YKNSLTDNRIVGITMAGTPLDSLYHDREVYRRLPYVTRLVIGHNVGKTHP
ELDDDDKIFQYLDSTFVMHPGDINHGVRLYYVQSLRDEVIPNMEADTIRR
LSNRTHILSLDDVHGSPSYGKTVRVYLLWSLLNSLNLSQLLSGVARLGFS
VLRRLKR
emeni-q5ara9: Aspergillus nidulans FGSC A4 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRR 194 / M139) (Aspergillus nidulans) hypothetical protein, 2 reference(s)Emericella nidulans Show
MGWILGEKFDTVYPHKGSIEALWETKWKAACEISVYPFHDGKLEDFEPIF
KKLIAENINDAYSDAYTEIFLPFAELLEQRAAAALRKGDGATASGLLLRA
AVVYRIARFPYVGPATTGLKRTAFERQKIAYLRAASLWKPQLQETVIGHT
HRKGKDGTHIPIYLCVPEDSSKPVPCVLIMTGLDGYRPDNTKRIHEIVSR
GWAVVICEIPGTADSPADPSDPSATDRLLDSVFLYMRQRTDIDMSRIALW
GLSAGGFYAIRAAHTHRNRLAGCIAHGPGAHYFLSEEWLNRVEDHEYPFP
IIRAWAKKYGYDDPADFCKNAQQKFSLLETGVLDRPCTRLLLLNGIDDGV
VPIEDCLLLFNHGSPKEGRFYPGLPHMGYPQSLDVAYKWLEDLLQTGSSS
Q
exode-q6bcb5: Exophiala dermatitidis (Wangiella dermatitidis) yellowish-green 1-like proteinExophiala dermatitidis Show
MSKEARLEDAHQLRSARWVSTRSCSAASRTLNPWRRRLLRCGIPVVVFVS
VLTRDQKGLKEPYDWDEYAQMYFPKAEELAKIAEEAEAAGEKEKASEYYL
RSSAVYRISRFPTPRSEKQKYAWRKGCEVFYKGAALLMEYPIKEVRIPHK
HGIEGEGDVVPVNFLLPPNASETSPVPCVLIITGLDGYRTELAVWQQGWR
SKGVATVIAEIPGTGDSPALRQDPTSPDRQWSSVLDWIESQKAVDSKKIV
AWGFSTGGYYALRMAHTHKDRLLATISLGGGAHHMFDREWLEHANKLEYP
FDLSNTLAYKFGYPDLESFIEESSKFSLLNDGTLQKPCTKVLLVNGNDDE
IFPIDDMFVSLENGQPKLARMVKGKKHMGEPESFSIILEWIHKLLGLDGK
IKEQLAMIPSRTKY
fussx-luc6: Fusarium sp. Lucilactaene biosynthesis cluster protein 6, 1 reference(s)Fusarium sp. Show
MHQIFPSTFFNFEFLRLLGTAPYLGAETGECLATAARIKDGDPESWYQAW
YEQAQKALALADEAKAVGDGPGAAWGYIRASNYFRASEFLLHCTPEDPRI
LSSAVASADAFDKGWILLDGSVRKVEIPYEGGNTLPGRLYLPAPHHQVSG
KIPVVVQTGGFDSTQEELYYYGAAGALPRGYAVFSFDGPGQGLSLRKDKL
YLRPDWEHVTSKVLDHVIGELAPVHNLDVDRLAVFGASLGGYLSLRAAAD
PRVKAVVSCDGPLDLFDITRSRMPPWFINGWLSGWLSDGFFNWVIDRLAS
VNFQLAWEFGHSKWVYGVKTPADVMRTMQKFSLKDGYLSKIKCPTLITGA
ADSFYFTPQQNAHPIFDSLSALGPAEKHLWIGKDVEGGGLQAKIGALALM
HHKMFAWLDETFGIRRDEL
gibf5-fus2: Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides) 20-hydroxy-prefusarin hydrolase FUS2, 4 reference(s)Gibberella fujikuroi Show
MHKVFASDFFNFEFLRLLGTVPFQGAEVGECLTTAGRIKDGDPESWYRAW
RDQAEKAQALAEEAAAVGDKTGACWAYIRAANYWRASEFLLHCTPKDPRI
LASSKASVNAFDKGWVLLDATVKNFEIPYEKDIKLPGRLYLPAPHHRLPG
KIPVVLQTGGFDSTQEELYFYGAAGALPRGYAVFSFDGPGQGLPLRVGKL
KLRTDWEYVVSQVLDFVTDDVAPEYDLDLERLAIFGASLGGYLSLRAAVD
PRIKACVSCDGPLDLFEITRSRMPPWFINGWLSGWVSDGVFNWVVDGLTA
VNFQIAWEFGHGKWVFGVETPADVLRVMQKISL