Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Duf_3141

Duf_3141


Genes:Proteins in Duf_3141 (83)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9burk-b1g6q9: Burkholderia graminis C4D1M Putative uncharacterized proteinBurkholderia graminis C4D1M Show
MDGAKQFSRSRDINAKVARILTKRSAVAHEHLTERVRTASGVDRDTAAAP
TTRAPTPWDTWSYGLDIIQRSVMFLDTLRERGTAYRERARQDPKPVLHFD
YESVLDGRQFERPVNYALLKIKPPEGVIVDPRKRPYLIIDPRAGHGPGIG
GFKDDSQAGVALRGGHPVYFLIFFPDPEPGQTLLDVCAAEQQFVKRLRTL
HPDSPKPALVGNCQGGWAAMMIAASDPDDTGPIVINGAPMSYWSGAWSEG
QGDNPMRYAGGILGGSWLASFAADLGAGKFDGAHLVQNFESLNPANTLWD
KYYHLFHNVDTEPPRFLDFERWWGDYYLMNREEIEWITHNLFIGNKLWSG
DVRGSSGKAFDLREIRSPIILFASLGDNITPPQQAFNWVADLYGSTEEIK
ARGQVIVGLMHQDIGHLGIFVSGKVAKKEHTQIVSVLEAIESFAPGLYGM
SITERKDANGETEYEVEFREHRLEEIAAHFNRFEREDEKPFEAVAQLSEF
NQRAYELFAQPIVQAMSNETTARLLREFHPLRLQRWAFSDLNPWLAWLPS
AASAVKTHRQPAEADNPWRAIEQSGSQMISASLDYYREMRDAGTEATFFT
IYGNLFSLYLADAKPAAESGAKSGTGPDSDPRDLPFVKEALASIREGGYT
EAIARAAALLSRKGEPLPLSRLVTRKELAQAYASYLPDLPADQWRRIRGE
QEIIVSFEQDEAIATLPVLVADRKDRARFITLLDELLKDERVQSTGPTEA
QRAMFDRIRQALTAKPTPGRSVAALARP
9burk-b5wax2: Burkholderia sp. H160 Putative uncharacterized proteinBurkholderia sp. H160 Show
MDAETLLSHSQDITAKITRVLQKRTQNAQRHLNDRVNDSLGLDHNDSAPA
SSAPAPFTALNAWQYTVDAAQRSLLFWDTLYRRGNEFVERSVSDPTPVLH
FDYDMLLDGRTFERPVNYALLQLRPLEGVGVDVRKRPYLIIDPRAGHGPG
IGGFKDDSQAGVALRAGYPVYFVVFFRDPEPGQTLLDVCNAEQRFVRKVR
SLHPDSPRPAIIGNCQGGWAAMMLASSDPDETGPIVINGAPMSYWSAAWS
EGEGDNPMRYAGGMLGGSWLASYAADLGNGKFDGAYLVQNFENLNPANTF
WDKYYHLYSNVDTEPPRFLEFERWWGSYYLMNREEIEWITRNLFVGNKLW
SGGVKDSSGQTFDLREIRSPIILFASMGDNITPPQQAFNWVADLYGSTEE
VKARGQVIVGLTHKSIGHLGIFVSGKVAKKEHTQIVSVLETIETFPPGLY
SMTINEVRNAAGELVYDVEFHERRLEEISAHLNRFGRIDEKPFEAVAEWS
TLNQRMYELLAQPFVQAMSNETNARMLRQFHPLRWQRWAVSAMNPWLGWL
PAAAQSVRDNRQRAGADNPWSKLEHSGSQMISASLDYYREMRDAATEAGF
FSVYANMYATFLGKASADGAAAQAGAINPRELPFVRTALQAVGEGGYTEA
LARAAFLLSVKGESLPLARYEMRKEIAESYAEYLPDITSDHWRRIRGEQE
IIVSFEPHEAIATLPKLLSHSEDRERFLQLLDKLMADERVLNGPHDAAQK
TALERIRAVLGSHVSRKRTAHLPDGTRT
9burk-b5wqb7: Burkholderia sp. H160 Putative uncharacterized proteinBurkholderia sp. H160 Show
MDQVTQPPRNQEIALKILRLLHNRLEEARQRFGQRTSDAIKGGDGASAAT
IPNPAQFTPWGAWHYTADFAQRSVLFWDTLRQRGNEFIERNKAGIKPALH
FDYDVVLDARHFERPVNYALLSIRPREGVVVDMKKRPYLIIDPRAGHGPG
IGGFKDDSQVGVALRAGHPVYFVVFFQEPEPGQTLLDVCAAEQQFVRKVR
ELHSDSPKPAIVGNCQGGWAAMMLASSSPEDTGPILVNGAPMSYWSGAWS
ESEAPNPMRYAGGILGGTWLSSLSADLGNGKFDGAHLVSNFEYLNPANTF
WDKYYNLFANIDTEPARFIEFERWWGSYYLMNREEIEWITRNLFIGNKLW
SGEVSGPSGKSFDLRAIRSPIILFASMGDNITPPQQAFNWVADMYSSTEE
IKVRGQVIVALMHEDVGHLGIFVSGKVAKKEYTQIFNVLETIETLAPGLY
GMSIKEAKGADGKTEYEVSLTEHRLEEAVEHFNELRREDEKPFEAVAAMS
EFNQRAYELFVQPVVQHASNETTARLLRDFHPLRLQRWAFSDLNPWLAAL
RPMADAVRASRQPSSDLEPWRTAEQRGSELISASLDQFRAVRDASIEALF
FSIYANLFAMHDPDLLGEQEAGTSAADPRSLPFVQAALASLRQGGYNEAV
ARTAFLLAPRGEPLPLSRIETVQQLVDEYADYLPHLPPADWRRIRGEQEL
IATFEPQQAIQTLPALLASPEDRNRLLTLLDKLLADRRVLRIPPTPAQEE
ALRAIRSVLGATTALESQPQKARAPRVRATAS
9gamm-c6n5e9: Legionella drancourtii LLAP12 Putative uncharacterized proteinLegionella drancourtii LLAP12 Show
MGYSMEKQDTELPYQIWRDFFSYQTDYWQRSILFLDTLRDRANNMMEHEQ
QGLPPLLDFKYELVLDGKTLEPKTNYALVKILEIGDVCFDKCFDPTAAPV
IVVDPRAGHGPGIGGFKRDSEIGIALHTGHPVYFVIFYPEPIPHQTLADV
LVTMRHFVEKAQALHEGKPPILYGNCQAGWMLALLASDCVGSVGLTVMNG
SPVSYWANSEEEANPMQLLGGLSGGVWSARFLSDLKDGTFDGAWLVSNFE
MLNPTTAIWDKYYGLFDDIDGEHDRFLEFERWWSGFYQFSQEEIIATVNN
LFIGDQFERGEMVIHKGCIYDLKRIHNPIVIFASQGDQITPPRQALHWIR
TIYPDTQALKKAKQRIVYLLHPSIGHLGIFVSAKVVRLQHRAILEHSAAI
EQLKPGLYEMIIVNPTGDPDCSKEQYHVRFEERDITELCASNSTKPFEKI
RQMSEANDSIYQSVAQPFVQKMSNPFLSWWLEKTHPMRLSRYVFSEQVNP
VMKPIELWGQSINADRQMITENNYFKKTEHALAEMIRDSFESVRKTRNTF
ITSLFEALYGKSN
9rhob-a0p290: Labrenzia aggregata IAM 12614 Hypothetical conserved proteinLabrenzia aggregata IAM 12614 Show
MRDIFDALEKGQNEFLESLHDATAWGPSERFTALQAQATELSNLGELMGR
GLSKHLTRISDDHKSRWQATVAEYGKAVKDMGGAQEAGSLYQAWEEYWQD
ATQRTVLTMDVLRQRGDNFMDHEEAGCPPVLIYDYEVVLDGADLPRPSCY
MLLKIIPPADLPCRDPKPFKRPYIIIDPRAGHGAGIGGFKPDSQVGVALH
DGHPVYFVAFKRMPEKGQTLADVTHAEAAFVRKVMELHPEAPNPVVTGNC
QGGWATLLLAAMNPDLTGPIILNGAPVSTWSGRVGENPMRYNAGVLGGTW
NAMYYSDLGHGIFDGADIVQNFEMLNPARNYFGKYYDLYSKVDTEPKRFL
EFERWWGGYFLLNEAEMKWIVEQLFVGNRLSKNEAQLETGRNVDIKHIRA
PIIVFASYGDNITPPQQALNWIIDTYTDEREIAIRGQRIIYMIHEQVGHL
GIFVSSKIAKKEHTEVTSTLKTIEALAPGLYEMTIDDYEGPLLEREFTVS
FHERKMEDLAKIDDGRDDEIPFAAVARASEQQAEFYDVCVRPFVQAFVTE
QSADLRRKSHPLRMQRALFSSLNPALGWLPGIAERARNERSPASAGNPFV
ELEKVNAALIEQSMDLFRDLRDTAYENLFYSIWGTPYMRWFGRSKQPGRT
LKRKDELRSLPPVQAALMHIEEGGFCEAVIRMLILLADSRGNVRRDRLER
SARVLTQDEPFKSLTADERSFILQEQTMIVEFAPEQALETLPKLLKTQEE
RELAAKVVRFVPGAIDEMTPHTLETLQQFHEVLGLPPVSEDILHDPLAVT
DVSVEPGKEDTRAAQEEAASNAPAKTPAKRTAPVKAASAAAVPSKSSPRK
PATRKAPARKTAVSRKPRSTAKKPQESAE
9rhob-a6e5f6: Roseovarius sp. Putative uncharacterized proteinRoseovarius sp. Show
MPYVQDAFERWVLLLDTLRERADNMIAHERQGMPPLLDFDYELLLDARTF
ERSANYALLRITRVGDDCWDDCVDEAKPPVIVIDPRAGHGPGIGGFKRDS
EVGMAMHEGHPVYFVIFYPEPMPGQTLSDVHYALRDFVLEVARRHPDTAP
VLYGNCQAGWAATLLAADCDGLTGPIVLNGSPLSYWSGEAASSPMRMMGA
LSGGAWAAHMISDLGDGRFDGAWLAQNFETLQPEKAIWDKYATLFAHADT
ERERFVEFERWWNGYYTLSREEILGITQNLFIGNRLEQGEMQLDAHCTVD
LKRISNPLIIFASDGDNITPPEQAMGWIGKLYPDTDALKAAGQRIVYMTH
PRVGHLGIFVSGSVARLQHRAILESLDDVEALSPGLYEMVIDNPSGDPDC
ETGDFEVRFEPREVDDLGIASDDAALKQVAQISRINEAVYSIFVSPWIRA
ATTPASAEALRALHPMRWTRTMFSEQVNPWMALIKSTAETLRETRSPLPD
DHPAIVAERALSARTGEGIGAWRKGRDAWITHVFGAMFGNFPFAAATTQA
EKPSASSKKGMNNYGMAF
9rhob-a9hui2: Roseobacter litoralis Och 149 Putative uncharacterized proteinRoseobacter litoralis Och 149 Show
MNKSLRLATVTPTQSSQPVPEQTSAGANVPYAQDAFERWLLFLDTLRERA
DNMIAHDRLGMPPLLDFDYELLLDARTFVRPANYALLWITRVGDDCWEDC
VDEAKPPVIVIDPRAGHGPGIGGFKHDSEVGMAMHEGHPVYFVIFFLEPV
PGQTLADVHYALRDFVTEVARRHPDKAPVLYGNCQAGWAAALLAADCDGL
TGPIVLNGSPLSYWSGEAASSPMRMLGALSGGSWAAHMIADLGDGRFDGA
WLAQNFETLQPEKAIWEKYVNLFSHADTERERFLDFERWWNGYYTLSREE
ILGITQNLFIGNRLEQGEMQLDAHCTIDLKRIRNPIIVFASEGDNITPPQ
QALGWIAKLYPDTEALKAAGQRIVYMTHETVGHLGIFVSGSVARLQHRTI
LESLEAVEALAPGLYEMVFDIPSGGAKRKTSDYDVRFVKRDVEDLGFGSD
HGALAQVAQISRINEAAYSTFVSPWIKAATSPASAEMLRALHPMRWTTTM
FSERVNPWMALVKSTADSVRETRDPLPKDHPAILAERALLARTGESLASL
RKARDAWLTHVFGAMYGSFPFATTTQTGQPPDTSNKE
9rhob-b6yy40: Pseudovibrio sp. JE062 Hydrolase, alpha/beta fold family proteinPseudovibrio sp. JE062 Show
MQIELFTQRTAQYFEALAQQNQFLQVANSRRSTRLMKDFQKKQEKSKIKG
EALAASWAPYDTPKKVMDAWTHYLKESSERAILTMDALRESSDTYFDHMA
KGCPPVLVYDYEVIVEGRNLPRPCNYMLLKIIPPEGTEVFDWKRPYVIID
PRAGHGAGIGGFKDDSQVGVALRGGHPVYFVAFHPMPEPHQELSHVTHAE
AAFLREIIARHPDSPKPIVVGNCQGGWATAILAAVYPDLVGPIVLNGAPM
SYWSGKMGQDPMRYSAGLTGGIVPALLSADLGNGVFDGANLVQNFEMLNP
GRNWFRKYYDLYTTIDSGEERYLEFQKWWNGFYYMTEEEFRWILDNLFIG
NKLAKNEAFLEPGRPIDLKTIKSPIIVFSSYGDNITPPDQALNWIADTYT
DDAEIEILGQRILYMLHDQVGHLGIFVSSSVAKREHTQVASTLKTIEAMP
PGLYKLQIEEQKGKGCDAKFKVSFARKTIDEMLLETGERDEEKAFAGVAR
FSESWEDMYDSTIGPVLKTMNSSQTAEVTRDLHPMRLANGAFASTNPFMF
WPTMAAAAVKQNHKPNMAKTPFHYWEEIVADSIEYGWDALKDMREAMIEN
SFLTFWASPQAVEYGKALSFRRPKVPMQDLHSLASIQNALKKIEKGGAAA
AIVRIVLMIADTRTEVRGEKLERFNEVLTTWAPFKSMDPKERNFLIHDQT
LIARFEMEAGYNALPLLLKNEKDKTFAYKAVTYIIGNEEDMAPNSLELWH
CLKKTLKWG
9rhob-b9r693: Labrenzia alexandrii DFL-11 Putative uncharacterized proteinLabrenzia alexandrii DFL-11 Show
MKDIFDAFEKGQNEFLNSLNDATAWGPSERFTALQAQGTELSNLAELMGR
GLSKHFEKITADHKGRWQLGLADMGKAVEDLSKGQRNGSLFDAWQSYWKD
AAQRAVLTMDVLRQRGDIFLEHEEAGCPPVLVYDYDVVMDGADLPRPCCY
QLLRIKAPEDGEHREIKPWKRPYVIIDPRAGHGAGIGGFKPDSQVGVALR
DGHPVYFIAFKRMPEKGQTLADVTLAEAAFVRRIMEEHPDAPNPIITGNC
QGGWATLLLAATNPDLTGPVVLNGAPVSTWAGRVGENPMRYNGGILGGTY
NAMFYSDLGHGVFDGADIVQNFEMLNPARNYFGKYYDLYSKVDTEPHRFL
EFERWWGGYFLLNEAEMKWIVEQLFVGNKLSKNEAQLEPGRNIDIKQIRA
PIIAFASFGDNITPPQQALNWIIDTYTDEREIAIRGQRIIYMVHDQVGHL
GIFVSSKIAKKEHTEVTSTLKTIEALAPGLYEMTIDDYEGGLLDREFSVS
FHERKMQDLMKIDDGRDDEIPFAAVARASEQQAEFYDVAVRPFVQAGVTE
QSAELRRKTHPLRVQRTMMSSLNPMFGGLPGMAERVKEDRTPADANNPFS
EMERVSAAMIEQSLDLFRDLRDTWYENLFYTVWGSPYMRWFGRTHQPGRT
LKRKEDLRSLPPVQTALMHIEEGGFCEAVIRMLILLADSRGNVRRDRLER
SARVLTQDEPFKSLSPDARSFMLQEQTLIVEFAREQAIESLPKLLKTKED
REMASKVVRYIPGAIDEMTPHTLEMVQTFQSVLGLPPVSEDITADPLVSG
EAGAPDTDGDTPKVTEKAASASPAPQKASAPKRAAKKAPAKSAAARKPGP
RKPRSTAGKKEEPAE
acicj-a5ft95: Acidiphilium cryptum (strain JF-5) Putative uncharacterized proteinAcidiphilium cryptum Show
MTIDFAARHKPAPGRAGRGPAIAAGNAGPAAVQLATAWPNYMIDAFQRSV
LFLELLRQRGNDEIAITARPVATVLRFDHDLVMSGQALPRPMNYSLLRIT
PPPGVITDLRKRPVVVVDPRAGQGPGIGGFKAESEIGDALDAGHPVYFIS
FAATPEPGQQFLDVVEGQVAFFERVVALHPGAPRPFAIGNCQAGYQTLMV
AMLRPDLFGPCLVAGSPMSYWQGVHGKYPMRYAGGLLGGSWLTAMSSDLG
RGRFDGTALVMNFDSLNPANWLWGKQYDVYTHIDTGGARYLAFEKWWGDF
IQLNGDELQFLVDNLFIGDKLTRGQLASSDGRIFDLRNIRSPIIAFASTA
DNISPPPQSLGWILDLYRNVDEIRAADQTIVYCLDHKIGHLAIFVSTKVG
AEQDEEFVQMIDVIDCLPPGLHEMIISPRPAETPRGGFVTGDWIARFETR
SLDDIRALGRNSPEDDRAFAAVARLSALNLAAYRRILQPLVRALANQPMA
DLTRALNPLRLSYTIFADRNPWMQVVRTMAAGVDAARRPVAADNPFLALQ
TQVSDQIIAGLDAYRAARDVMAEQVFFGVYGSPFVQALLGITDRTEARPT
PGPSPEQRALQEVHAKVYAAKLKSGGFDEALTRAVLYVLAADHVLDQRCA
LALNAARWTIMHLSLAAFKAVVRDQAFLLLLEREQAIAALAVLVPEADAR
TALLSQVRAIVGAAGPPSSAESDRLLRLKQALAPPPRRPTATAAASGKPQ
AVSH
acide-c5t1r9: Acidovorax delafieldii 2AN Putative uncharacterized proteinAcidovorax delafieldii 2AN Show
MKTPTSPQKPRTSQRTTAGGKEAAVQGTHRQAEDLPPTVLDHSEELLKSA
PQDASSGMKRAAEAPSTQDYFDYQRDFFERTILFWDTLRQRANNMLEHER
AGLPPLLDFKYETLLDARSFDRPVNYALLRITEIDGHCWEDCVDSDKPPV
IIVDPRAGHGPGIGGFKRDSEVGMAMREGHPVYFVIFFPEPALGQTLADV
LHVLRRFVEEVALRHPGNPPVLYGNCQAGWAVTLLSADCAGLVGPVVLNG
SPLSYWAGESGVNPMRLSGGLLGGSWLAHLTADLGNGRFDGAWLAQNFEN
LKPEKAIWEKYAQLFTNVDSEQARFLEFERWWNGFYFLSREEILAIVENL
FIGNQLEQGVFQICLGCTADLRRIKNPIVIFASYGDNITPPHQALGWIPA
VYSDTEDLKRAGQRIVYLTNRHVGHLGIFVSAGVARLEHRAILESLAEIE
ALAPGLYEMKIDNPSGNPDCHKPTYSIRFESRQVEDLKTDYPQEAFERVK
QVSTFNEVLYRAFVSPWAQTLSTPWTAEVLKWLHPMRSSRYLFSETLNPW
MKGVSVLAEPLARSRQPLAPHHPLIEREREAAGQVTHALGRLREGRDAAV
EQAFRLMFQRPD
aciet-b9mbf1: Acidovorax ebreus (strain TPSY) (Diaphorobacter sp. (strain TPSY)) Putative uncharacterized proteinAcidovorax ebreus Show
MKAPTPTPKPQSSPSARPRRGKAAIQRVQRLAEDLQPAVLDHSEELTKPA
AQETSSGMKGATDALSAQDFFDYQRDFFERSIAFWDTLRQRANNMLEHER
AGLPPLLDFKYETLLDARIFERPVNYALLRITEIDEHCWDDCVDPDKPPV
IVVDPRAGHGPGIGGFKRDSEVGMAMREGHPVYFVIFFPEPALGQTLADV
LHVLRRFVEEVAQRHPGKPPVLYGNCQAGWAVTLLSADCAGLVGPVVLNG
SPLSYWAGEPGVNPMRLSGGLLGGSWLAHLTADLGNGRFDGAWLAQNFEN
LKPEKAIWEKYAQLFTNVDTEQGRFLDFERWWNGFYFLSREEVLAIVENL
FIGNQLEQGLFKICQGCTADLRRIRNPIVIFASYGDNITPPHQALGWIPA
VYQDTDDLQQAGQRIVYLTNPHVGHLGIFVSAGVARLEHRAILESLADIE
ALAPGLYEMKIDNPSADPDCHKPSYSIRFEPREVGDLKTDYPQEAFERVK
QVSTFNETLYRAFVSPWAQSLSTPWTAELLKWLHPMRSSRYMFSETFNPW
MRGVSMLAEPLARSRQPLAPHHPLIEREREAAEQVTQALGRLREGRDAAI
EQAFRLMFQSPDVLLSVLGTMGKTGDGSAGRHKAD
acisj-a1w9c9: Acidovorax sp. (strain JS42) Putative uncharacterized proteinAcidovorax sp. Show
MKTPTSPAKPQTSQSARPQGRKAEIQKVQRPAEDLQPTILGHSEESMKPA
AQEASSGMKRATEALSAQDFFDYQRDFFERSILFWDTLRQRANNMLEHER
VGLPPLLDFKYETLLDARGFERPVNYALLRITEIDEHCWDDCVDPDKPPV
IVVDPRAGHGPGIGGFKRDSEVGMAMREGHPVYFVIFFPEPALGQTLADV
LHVLRRFVEEVAQRHPGKPPVLYGNCQAGWAVTLLSADCAGLVGPVVLNG
SPLSYWAGESGVNPMRLSGGLLGGSWLTHLTADLGNGRFDGAWLAQNFEN
LKPEKAIWEKYAQLFTNVDSEQRRFLDFERWWNGFYFLSREEMLAIVENL
FIGNQLEQGLFQICQGCTANLRRIRNPLVIFASYGDNITPPHQALGWIPA
VYQDTDDLRRAGQRIVYLTNPHVGHLGIFVSAGVARLEHRAILESLADIE
ALAPGLYEMKIDNPSGDPDCHKPSYSIRFEPREVKDLKTDYPQEAFERVK
HISTFNEALYRAFISPWVQSFSTPWTAEMLKWLHPMRSSRYLFSETFNPW
MRGVSMLAEPLARSRQPLAPHHPLIEREREAAGQVTHALGRLREGRDAAI
EQAFRLMFQSPDLFLSILGTMGKTGDGSAGRHKTDGALI
acisj-a1w603: Acidovorax sp. (strain JS42) Putative uncharacterized proteinAcidovorax sp. Show
MKIPTSPQKPRTSQRTTAVGKEAAVQWTHRQTKDLPPTVLDHSEELLKPA
PQDASSGMKRAAEAPSAQDYFDYQRDFFERTVLFWDTLRQRANNMLEHER
AGLPPLLDFKYETLLDARSFERSVNYALLRITEIDGHCWDDCVDSDKPPV
IIVDPRAGHGPGIGGFKRDSEVGMAMREGHPVYFVIFFPEPTLGQTLADV
LHVLRRFAEEVAQRHPGNPPVLYGNCQAGWALTLLSADCAGLVGPVVLNG
SPLSYWAGESGVNPMRLSGGLLGGSWLAHLTADLGNGRFDGAWLAQNFEN
LKPEKAIWEKYAQLFTNVDSEQARFLEFERWWNGFYFLSREEILAIVENL
FIGNQLEQGVFQICQGCTADLRRIKNPIVIFASYGDNITPPHQALGWIPA
VYSDTDDLKRAGQRIVYLTNPHVGHLGIFVSAGVARLEHRAILESLADIE
ALAPGLYEMKIDNPSGDPDCHKPSFSIRYEPREVEDLKADYPEEAFERVK
QVSTFNEALYRAFVSPWAQALSTPWTAEVLKWLHPMRSSRYLFSEAFSPW
MKGVSLLAEPLARSRQPLAQHHPLIEREREAAEQVTHALARLREGRDAAV
EQAFRLIFQRPD
aroae-q5p962: Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) Putative poly(3-hydroxyalkanoate) synthetase, 1 reference(s)Aromatoleum aromaticum Show
MNFPIPVPSAATLPMMDPFGFARSAFDYWRDAVERSVLFMDVMRHRGNQY
LEHIEKTKPSVLGFETEVLMDGRELPRPVNYELMRVLPPAGIEIDPQRRP
FVVVDPRAGHGPGIGGFKPDSEIGVALRAGHPCYFVGFLPYPEPGQTVED
VVEAEVAFLRCVIERHPTTAEKPMVVGNCQAGWQIMMAAALEPDLFGPIL
IAGSPLSYWAGERGKAPLRYTGGLSGGSWMTALLSDLGNGLFDGAWLVQN
FENLNPANTWWTKQYRVFANVDTEAVRYLEFERWWGGHVVLGGQEIQYIV
DNLFIGNRLSTAQLMTSDGRRIDLRNVRSPVVVFCSRGDDITPPPQALGW
VRDLYEGVDGIIANEQTIVYCVHDSTGHLGIFVSGSVSRKEHTEFTANMD
YIDVLPPGLYETSISRADERADAGLIEREYLLEFTPRTVAELDREIGHQP
DDEARFATVARISEINLGLYRLFLQPWVRALATPSSAKWMRRMHPNRLGY
RLLSDRNPLTLSLPALAEKVRADRHPVGEDNVFRRAETLVSEQIARGLDT
WSDLRDKASEQLFMSIYGQPLLQVLVGLRADGQPHRRRPGTELEHRRFIQ
RRQAELHDRIAAGGSHEAKMRSIIYVLGGAPATDERNFKRMRASRAELEP
SLKLADFKNLLREQFFILKHDREAALEAIPTLLKGQSAAQIDTHLNQIEH
VLAASGELSAHAADRFKRIKSLFHRARPNATAVALTSPGAAPQSPSAAMN
EPASPAPIAKAAEPRQTVTSGLPVSESQGAQASDTGRMPDGDKPAAAPGR
RAPRKPRNA
azoc5-a8ih86: Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571) Putative uncharacterized proteinAzorhizobium caulinodans Show
MAGESATPAPLQPGTWGQPGHQAAPWSGVFAEAWSRAFTGTAPLPPGIGT
LPAGPLVDYLVDAAQRSVLFIDLMRRRGNEQQDITSRPMATVLSFDHDVL
VSGRALPRPINYFLSRIVPPPGAKVDPDKRPVVVVDPRAGQGPGIGGFKT
QSEIGEALANGHPVYFIGFSAQPEPGQTFLDVVEGQVSFFERIVAMHPDA
PRPFAIGNCQAGYQTLMVAMLRPDLFGPCMVAGSPMSYWQGVHGKNPMRY
SGGLLGGSWLTALVSDLGRGKFDGTWLILNFDSLNPANWLWGKQYDLYAA
VDTEAQRYLGFEKWWGDFITLNGDEIQFLVDELFIGDGLTRNEMRSSDGT
VFDLRNIASPLIVFTSLGDNISPPPQTLGWILDLYKDVDAIHAEGRTIVY
CLNQTVGHLAIFVSAKVGAKEDEEMVRLMDLIDCLPPGLYELVISPASEE
EVKAGGHPWHSRFEARSLEDIRAFGRNSVEDDRAFAAVRRVSEINLSLYR
TFLQPAVRALANPHMAELLFATNPLRLSYSLFADSNPFMKPVAKAAAEVT
AARKPVPPDNPFLAVQKLWSDQISAGLDAFRDLRDRAVEQAFFGIYGSPV
LQGMLGLNLDEKVRELPPTSPQKRAFLTQKMAEFRDRVDEGGFNEALVRS
VLFVIAADRQLDERCAAALKETCLRLTQLSISDFKSLVRRQFYILLLEGI
AAVEAIATLVPDGAARQSLLNDAAAVAGANGTLTIGEQQNIEKLAEVLGV
AAPHSPAPVLPADTHRSAPSTLQIAPAGA
azos1-d3p281: Azospirillum sp. (strain B510) Putative uncharacterized protein, 1 reference(s)Azospirillum sp. Show
MMWPMMDLARQAQDYWIDASQRSILFLDVLRRRGNTHFEHGARTAPNVLG
FSFEFVADGRLLERPVNYGLVRIVPPAGVAVDDRKRPFIVFDPRAGHGPG
IGGMKQDSEIGVALKAGHPCYFVGFLPDPLPGQTVEDVCRAEAVFVEVVA
RLHPDADGKPCLIGNCQAGWQIAMMAATHPDRVGPLLLAGAPLNYWAGVH
GKNPLRYLGGLLGGTWQTALAGDLGAGIFDGAALVANFERMNPANTLWKK
GYNVYSKIDTEEERFLDFETWWGSPVLLNAVEMQFIADELFLRNKLSSGE
IVFSDGMRVDLRNIRTPIVVFCSWGDDITPPQQALGWILDLYDTDRELIA
GGQTIVYALHQSIGHLGIFVSAKVANKEHDEFARTMDLIDVLPPGLYEAV
FTEKTTDMPHPELVSGDHLVRFERRRLDDIRALGGNDAADDRRFATLARL
SALNKGLYRATLGPVVNALATPQSAGALRAMDPYRLRFAAFSDRNPLMAL
VPPLAEAVRAHRRPVPVDNPLLGLQKAISEQIVLALDMARDVRDRATEGF
FLTVYGSPQLQTLLGIDPNRPVPGHGRPGRDLTREAAILRAVADLSARMD
QGGLAEAGLRALLYIDLGRTQVGADERGFAMLRHIRRRLFADRPFSLAYF
KAMVREQYLLLLIDEERAVAAIATLLEDDPSGRAGMLDAIRLVVAASGEL
SQDAGRRLDRVESLFASVSGKTMPAARGMVGIAGS
azosb-a1k5s0: Azoarcus sp. (strain BH72) Conserved hypothetical, 1 reference(s)Azoarcus sp. Show
MQLFPSPLAPSGHALQLLPAAFAGISGLFRHQLHTAAAAVHYLYDRWQRQ
ILFIDVLRERGNQYIEHSRSGKPPVLAFDYEIIMDGRRLPDPANYALARI
HPGPDCPPTDPTRRPFVVIDPRAGHGPGIGGFKIDSGIGIALQQGHPCYF
VMFFPTPEPGQTIESVTRAEHAFLSRVNELHPEASQPLVIGNCQGGWALM
MLAASAPRVVGPILLAGSPVSYWAGVRGKNPMRYTGGLMGGTWLASLVGD
LGNGRFDGALLVNNFELLNPANTFWGKPYGLFANVDEERERFLEFERWWG
GHFLLNKAEMEWITQNLFVGNRLSAGDIVSSDGRIRIDLRNIRSPIIVFA
SWGDNITPPQQALNWIHDLYEDVEDIRLNEQTIVYCLHEKIGHLGIFVSA
SVAQKQTNKLVGALELIDILPPGLYEAVIEDTHPEMPGREYVQGRFHVRF
EPRSIDDILALDDGREDERAFEVVKRVALVNQGLYDTFVSPWVRLFSSEL
MAETFRNLNPARFERLWFSDANPLLWPLAPIAGLIAHKRVPASDDNPFVQ
LEKQVSGQIEQSLNHYRDSRDHLQEQLFTTVYEAPLLQALVGLGQGVVRR
REQAHTWMEDEFRNLQRRVLTEDFEHGSVLDGIVRTIFFTKPDLLGFDER
PFNLLRQGLEHAGLGGRHALADLKQILKRQALLFLLDEDRALAGLPALLP
TPELRRRALETAYALGRARGDLGEVFQQRYARVAAQLDVAPETAAEQAPV
LEAPPTALAAPSAPADDGGPARRRRPRKGTDERA
azosb-a1k696: Azoarcus sp. (strain BH72) Putative uncharacterized protein, 1 reference(s)Azoarcus sp. Show
MPLSAGSGPAFLSVVPARRPATRAGRRRLATSVLARHDHLDDLRVRLFAR
ARRLSQRWARQSSQRPPSPAETLAYALDCTRRAVLLADTLRQRGNDFLDY
EATGQPPLLAFDYEVLIDGRQLPRPVNYCLVRIVPPDGVEVDETKRPYLI
IDPRAGHGAGIGGFKQESQVGVALQAGNPVYFAVFYPEPEPGQTLACVAA
AQLRFVREVAARHPRSPKPALVGNCQGGWAVMALAAVDPGIAGPVVLNGA
PLSYWAGVRGRDPMRYLGGLAGGSWPSYLLGDLGHGHFDGAWLVQNFEGL
NPANTVWTKYYRVFRGGEEEARRFLDFEKWWGGFVQLTADEMRGIVDDLF
VGNKLATGGIPLGRGQTLDLRRVRSPVVVFCSQGDNITPPQQALNWIADT
YSCTREIKAHGQTIVYIIHADAGHLGIFVSGSVVRREFSQIAGTLANIEA
LPPGLYELTITDTHIDEHGVQQYDVSLHEREIEDILAHDDSREDERAFHI
VAAVSELNGRVYDLFVSPWVRQGASALSAWWMKELHPLRVQRRAWSDLNP
WLWWVPVARERLGEGPEVGEANPWLSWETALSDVVEAGFDTVRDVRDAML
ETLFHSIYGALDALGAGDRLAKARLFSAGGAEDVAALALAAMTEGGVREA
VVRMLLLLMKAGGSVRRETLAYVQSQLREAHVFQELDAEALRALLVMQST
IVAYDPARALETLPALLPTPELRADALRVLRAVLPATALARPQLQAAMEQ
FRETLGEQPASPA
azovd-c1dgm6: Azotobacter vinelandii (strain DJ / ATCC BAA-1303) Poly(3-hydroxybutyrate) depolymerase, 1 reference(s)Azotobacter vinelandii Show
MADASADPPAPWTLWNDWCRYGLDVAQRSILFWDTLRQRGDNYLEHVRQG
QPPLLHFEHETVLDGRTFARPVNYALLRILPPAGMEADPRQRPYLIIDPR
AGHGPGIGGFKDDSEVGVILRERHPVYFVAFFRLPEPGQSLLDVCAAEQV
FVRKVRELHPDSPKPALVGNCQGGWATMMLAATDPDSAGPVVINGAPMSY
WGGAWREGEGDNPMRYAGGLLGGTWLASLASDLGNGLFDGAHLVENFENL
NPANTYWDKYYHLFANIDGEPPRFLEFERWWGGYFLMNREEIEWITRNLF
VGNRLWSGETGAGRGKPVFDLRDIKSPIVLFASLGDNITPPQQAFNWVAD
IYASTEEIKARGQIIVGLLHQDIGHLGIFVSGRVARKEHAQIVSVLKSIE
MLPPGLYGMAIHERPGAGGKLEYEVEFHEHRLEDVSARLNRLQRVDEKPF
EAVAALSEFNQRGYELFLRPLVRLMASERSAELMRQLHPLRLQRWAFSAR
NPWLWWLAPAAAAVRKQRQAPVASRDDLPHHGERLASELISASLDHYRAL
RDAAGEALFFQTYGSLFSLILDESPPPAASAEAQELPFVQEALDAIGEGG
YDEAFARVAALLARKDELSLARLVTKQEIVRDYADLLPRLPPETWRRIRG
EQEIIVNYAREQALATLPALLAGPAERERLLTLLERLAADERVRRSEPSA
EQRAMLERIHDVLGRAPAVGQPTARSA
azovd-c1dif2: Azotobacter vinelandii (strain DJ / ATCC BAA-1303) Esterase, poly(3-hydroxybutyrate) depolymerase, 1 reference(s)Azotobacter vinelandii Show
MSQETFFAQQEDCFSSFHNYVQHIGKLQKLQSDNLQDGIRRRQEKSLQKL
TACATRQIGPGDWLDYLSDFNQRTLLFWDTLRRRADGTLEHRRAGYPALL
KFNYELLLDGRDLPAPVNYSLLHILPGPSQTTDPSLPPVIVIDPRGGHGA
GIGGFKEDSEIGESLRAGHPTYFISFSHSSEPGQTLSDIALAEARFIELV
SERHAHAGKPVLIGNCQAGWALMGLAALRPELPGLLIVVGAPLSYWAGVN
GRNPMRYAGGLLGGAWMTRLGSDLGNGRFDGTWLVNNFENLDPAHALWGK
YYDLFSSVDSEAQRFLDFERWWGSPNLFNSEEIETIVDELFIGNRLTGGQ
NTLTDLRKIEAPVVVFCSYGDNITPPQQALNWIADLYPSDLALHSSGRTI
IYLKHASAGHLGIFVSGQVARREHRQLIGAIDAIKALPPGLFELIIDEVP
HPDGGAQSYQVHFESRRIADILAEDDGHDDEREFELVDRVSAISSTFYDW
TVRPWLSRAINEPVAEQLREHHPFHLQRQLWSSLNPATWWLSGTAELARR
RRNPVRPDNPLLAWQEFFSDSVENTLDTWRDLRDASQELAFHTLYGWFST
LAGGQRTSAAEKFASERERTLLERLYAALPQGGAREAAIRILLLLARASG
RLDKAMLEGIVKDYRRRAYADPHIPDVATLREITRQQNLLVFAYPEESLQ
TLPELLPDTSVRQRILAEVLNIEPGWQRSDGPLGALWRQLFEVLELPTAE
FALLRLESPATAEQPAEVDAAATPESTPPTAEPKIRPAAETAAVPAKRQE
VLIEPVPTAVPEPTETAAAPKAAAPEPIAAPAEPAGQAPAETSPAEAAPK
PHIRVRANTVISEPLETLPSAEAAPADSGKPPAKAAATKRTTAQRTVKPR
RPRKPGGTQPSDNT
azovd-c1djw3: Azotobacter vinelandii (strain DJ / ATCC BAA-1303 AvOP) PHB de-polymerase, 1 reference(s)Azotobacter vinelandii Show
MAESQSPRGSGLSCASVPAFWPMTMAAELAEKGLELYARNLRFIQEEIRI
HGELRPSLATPNQVRLGLRTMFLRDYGRPGEGIPTLVDAPYAGHTAMIAD
YHAGQSLVETLLANGIGHVALTDWKSATEDMKDFEIDNYLGELVVAIDDL
GGRVNIVGLCQGGWTAAMLAARFPDKVNSLVLAGAPIDTDAGDGPIRGMV
HESPISFYEDLVALGGGLMKGEFMLQGWKNMRPGEHYILEHIDLYEHIDD
PVYLRKKETFESWYENPIDLPGRWYLQVIGQLFKENRLARGEFAGLGRRL
DLRDITCPLYLLAGEGDDITSPEQVFNAANLVGTPQERIVRQLVPGGHIG
LFMGARTLTERWPGIARWIAAQ
beii9-b2icg9: Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCI 8712) Putative uncharacterized proteinBeijerinckia indica subsp. indica Show
MTNERQGETPDFFTNPFTAFWPTGAKNGFSIPAFPSELFPSFLSPRAVPS
PVFALQGKSSPATSWIDAFGLKPYQDYWQDAWQRSILFLDILRQRGDQYL
ERSQRDVPHVLSFGAELILDGRTFERPVNYGLVRIIPPQGVTVDPTKRPF
IIFDPRAGHGPGIGGMKHDSEIGEVLKAGHPCYFVGFLPQPVPGQTIEDV
CRAEALFVKKVAELHPDSDRKPTLIGNCQAGWQIAMMSALNPDLPGPLLL
AGAPLSYWAGVHGRNPLRYLGGLLGGTWMTTLAGDLGNGIFDGAALVANF
ERMNPANTYWKKNYNVYSKVDSEAPRFLDFESWWGNPITLNAQEMQFIAD
ELFVGNKLTCGEIVTSDNVRVDLRNIKSPIIVFCSWGDDITPPQQALGWI
TDLYDSRDEIVANGQTIVYTLHDSIGHLGIFVSGKIATREHGEFTQAMDL
IDLIPPGLYEAVIADVGQETANPELIEGRYLLVLQPRNLDDIRALGGNDL
ADERRFASLARLSDVNQGLYRTFASPVVRSLVTKESADYLRRLHPNRLRY
AFFSDRNPWLRPVKALAEHVRANRHPVTKDNPFVLLEQGLSNTIISTLEN
YGHWRDTLEENFFLTFYGSPTLQALLGLGADPTRPPRQLGREVTREAIAN
AKRAALEFAFDKGSTVEAFVRASIYIHQPIPSIDERVLAALKEVRQLLPT
DKLTFSRFKDIVKQQHQIVLLDEKRALATLPQLLPASRKERTDLFEAIQR
LVLAGGQLPEEAQKRLFEIKTLLSGAKDQTEDRISAAE
beii9-b2igq5: Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCI 8712) PHB de-polymerase domain proteinBeijerinckia indica subsp. indica Show
MEQTLSAPQKPESYLDLPFFWPFKNVTNMTEEGLTLLKKNLEFLAEEQKF
KHGLEPHLATPNTIKLDLRTVRFRDYSKPDATGIPTIVDAPFAGHSAMIA
DYHKGQSLMETLAANGIDNLYLFDWKSATLDMKDLEIDQYLAEINVCVDD
VGGRVNLIGLCQGGWMSAMYAARFPHKVASLVLAGSPIDTDAGNGPIKQM
AHTYPLSFYQELVQMGEGLMRGKFMLAGWKNMHPEAHYFQNYIDLYEHID
DPNYISKEETFASWYEHPIDLPGRWYLQAITQLFKENRFAKGTFVALGET
LNLKNVTCPVYLLAGETDDITTKEQVFDADKYLGTPKDQIQKQLVPGGHI
GLFMGTHTLKQAWPGIAAWIRTNGK
beii9-b2iia7: Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCI 8712) Putative uncharacterized proteinBeijerinckia indica subsp. indica Show
MSSTQEQSPPISPLALIGLFAPAMGYFVDAAQRGILFLDVLRQRGNQYHE
HIAKTAPHVLSYQAELVIDGRQLVPPVNYALARVIPPPNVELDPTRRPFV
VIDPRAGHGPGIGGFKADSEIGVAFKAGHPCYFIGFLPDPVPGQTIEDIT
QAEAIFLKKVIDLHPEADGKPCVIGNCQAGWAVMMLAALYPELFGPIIVA
GSPLSYWAGVRGRNPMRYSGGLLGGSWLTALTSDLGNGKFDGAWLVQNFE
NQNPANTLWTKQYNLYSKIDTEPERYLDFERWWGGHVNLNAQEIQFIVDE
LFIGNNLAAGRIQTSDGTAIDLRNIRTPIVVFCSKGDNITPPQQALGWIL
DLYQNVDEIRSYGQTIVYTIHET