Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Duf_452

Duf_452


Genes:Proteins in Duf_452 (340)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9bace-a0a1c5tih6: environmental samples uncultured Bacteroides sp Uncharacterized protein conserved in bacteriauncultured Bacteroides sp. Show
MKQLFIKKEGNPVLLLFFAGWGSDENLFGSPVPEGCDYLLCFDYKNMDFD
YSLLDAYQEIRVLAWSMGVWVACQTLTGKDYPYGMRLAVNGTPYPIHDTK
GIPEAIFRGTLENFSEPVLVRFRRRICGSAAQVKVFLAHHPYRTLEDLHQ
ELADEWTMVKALPVWEWDWDKAIVGTSDKIFPPQNQREAWQGVPVEEKDV
EHYDEELFRQLLSGESSLWTRP
9bace-a0a1c7h3f1: Bacteroides caecimuris Biotin synthaseBacteroides caecimuris Show
MKQHFIIKNNQKHLLLFFAGWGMDETPFLQIHPTDKDWMICYDYRSLEFD
AGILQEYSEITLIAWSMGVWAASQIMKQYPSLPLSQSIAINGTLYPIHET
KGIAPAIFEGTLQGLNDQSLQKFQRRMCGSAADYKAFQTVVPQRPVEELK
EELAAIQKQYLSLPPSDFAWQRAIIGKSDRIFLPDSQWLAWSNKVDSLEY
AEAAHYQVELFDNVIMQIN
9bace-a0a1m4y0z4: Bacteroides faecichinchillae Biotin synthesis protein BioGBacteroides faecichinchillae Show
MIQKFLIKNSHPHLILFFAGWGMDETPFQQIHSNDCDWMICYDYRSLDFD
DTLIQKYSHITLIAWSMGVWVASQIMQKFSYLPIVYSIALNGTLYPIDDT
RGIAYSIFDGTLQGLNEQTLLKFQRRMCGSAVEYKEFLSVVPQRPVEELK
DELTAIQCSYLALPPSSFIWQKVIIGKNDRIFLPENQWQAWKDKVDMIEE
TDGAHYQKELFYLPLKHLFSTD
9bace-a0a1m6im87: Bacteroides stercorirosoris Biotin synthesis protein BioGBacteroides stercorirosoris Show
MIQKFIIQKKHPRLLLFFAGWGADETPFKNYQPANSDFMVCYDYRNLSFD
AQVLEGYEQVNVVGWSMGVWAASQVLGKIIADETSGIITDETSRSRQLPL
GKKIAINGTPFPIDEERGIPPAIYHGTLEGLTDASLHKFLRRMCADSAAF
RNFLAVTPRRPLEELREELAAIEVAYTTETAYPFGWNTSVIATEDRIIPS
ENQKKAWTRDGRSEPFLAEAHTLTEIETAHYAHELFETYLEKEWTND
9bace-a0a108t473: Bacteroides cellulosilyticus; Bacteroides intestinalis; environmental samples uncultured Bacteroides, Uncharacterized proteinBacteroides cellulosilyticus Show
MDDADETDERGVLIFHPCRPRTLEKRYRIMKQVYIIKDRHPRLLLFFAGW
GADETPFKDYQPADSDYMLCYDYRTLEFDASLLKEYCEINVIGWSMGVWA
ATQVMGKLQETDTALVIKNSIAINGTPYPIDDTYGIPTAIYHGTLEGLTG
PSLHKFLRRMCFNGEAFKEFLNITPRRPLEELKEELAEIERMYLSLPATS
FYWQQAVVGNNDRIIPPDNQLNAWRKEAEISRKTLRVHYTEDAHYQVELF
RYYLQEIWTKD
9bace-a5zhq0: Bacteroides caccae Putative uncharacterized proteinBacteroides caccae ATCC 43185 Show
MKQHFIIKNNQKHLLLFFAGWGMDETPFLQIRPTNKDWLICYDYRSLEFD
AIILQEYSEITLIAWSMGVWAASQIMKQYPSLPLSQSIAINGTPYPIHET
KGITPAIFEGTLQGLNEQSLQKFQRRMCGSTAGYKTFQTVAPQRSIEELK
EELAAIQKQYLSLPPSDFAWQKAIIGKNDHIFLPDSQWLAWRNKVDSLEY
TEAAHYQQELFDNVIMHIN
9bace-b3cav2: Bacteroides intestinalis DSM 17393 Putative uncharacterized proteinBacteroides intestinalis DSM 17393 Show
MKQVYIIKDRHPRLLLFFAGWGADETPFKDYQPADSDYMLCYDYRTLDFD
ASLLKGYKKINVIGWSMGVWAASRVMDKLQETDTSLIIKNSIAINGTPYP
IDDTCGIPSVIYHGTLEGLTGPSLNKFLRRMCFNGEAFKEFLNITPRRPL
EELKEELAEIERMYLAQPTTSFHWQQVVVGSNDRIIPPDNQLNAWRKEEE
NNRKKIRVHYTEDAHYQVELFRYYLQDIWTKD
9bace-b3jqy3: Bacteroides coprocola, Putative uncharacterized proteinBacteroides coprocola DSM 17136 Show
MKQLFIKKENSPRLLLFFAGWGSDENLFRRTVAEGYDCLLCFDYRTLEFD
YSLLDGYREIRLLAWSMGVWVAGQILSGHTYPWEMKLAVNGTPFPIDDRR
GIAEAVFHGTLENFSDATLARFRRRICGGAGQVKEFLSHQPYRTAEELGA
ELAALEHEVGKVQPAAFVWDKAIIGLCDKIFIPANQRTAWTGTEVMEMEA
EHYDTVLFDRLLEGKGEEWTRR
9bace-b5czm3: Bacteroides plebeius DSM 17135 Putative uncharacterized proteinBacteroides plebeius DSM 17135 Show
MKQRFIKKEGNSTLLLFFAGWGSDENLFAGPVQEGCDCLLCFDYKDLDFD
YSLLEGYREIRVMAWSMGVWVACQTLAGKEYPYGMRLAVNGTPFPIHDTK
GIPEAIFQGTLENFSEPVLIRFRRRICGSAAQVKTFLSHHPYREVDDLHQ
ELAVLWTEVKNRPAVEWTWNKAIVGTNDKIFPPQNQREAWRGVAVEEVDA
EHYDEELFRELLNGESRLWTRP
9bace-b6w493: Bacteroides dorei Putative uncharacterized proteinBacteroides dorei DSM 17855 Show
MKHYFIQQNYFPRLTLFFAGWGMDECPFMDYCSGNSDLLVCYDYRSLDFD
FTLLQGYQEIRLIAWSMGVWAASMVLQDMDLPICESVALNGTVTPVDDLK
GISQQVFEGTLEGLNEVTLEKFIRRMCLKKENLETFLLKRPQRAVEELQE
ELRRIGEQVKSCAVPSFAWERAVIGKNDLIFTAVNQRNAWTGTEVAEYDI
PHYSEEIMRDLLCPSVI
9bace-b7ah93: Bacteroides eggerthii Putative uncharacterized proteinBacteroides eggerthii DSM 20697 Show
MKQVYIVHENHPKLLLLFAGWAADETPFKQYRPKGMDYMVCYDYRTLDFD
KSIFDRYQRVNVVTWSMGVWVGSLILSNIPQNKILSIAFNGSISPIDNLE
GIPLKTYQATLDGLTPASLQKFLRRMCKDSDAYKAFMEITPRRNFDEIKE
ELRLIKEQYFEMHGSIEKKDIYNEKDEDKFQEYYDKYNYEYDYVFIGNND
RIFPPENLRINNESPVHSNVILTDNAHYDEPMFRFLLQDMWEMTVDDFIC
HLKTINIDETIEE
9bace-c3r501: Bacteroides dorei 5_1_36/D4 Biotin synthesis protein BioC N-ter subunitBacteroides dorei 5_1_36/D4 Show
MKHYFIQQNYLPRLTLFFAGWGMDECPFMDYCSGNSDLLVCYDYRSLDFN
FTLLQGYQEIRLIAWSMGVWAASMVLQDMDLPICESVALNGTVTPVDDLK
GISQQVFEGTLEGLNEVTLEKFIRRMCLKKENLETFLSKRPQRAVEELQE
ELRRIGEQVKSCAVPSFAWERAVIGKNDLIFTAVNQRNAWTGTEVAEYDI
PHYSEEIMRDLLCPSVI
9bace-c6z7l8: Bacteroides sp. 4_3_47FAA Biotin synthesis protein BioCBacteroides sp. 4_3_47FAA Show
MKHYFIQQKHLPRLTLFFAGWGMDECPFMDYCPENSDLLVCYDYRSLDFD
FTLLQGYQEIRLIAWSMGVWAASMVLQDMDLPICERVALNGTVTPVDDLK
GIPQQVFEGTLEGLNEVALEKFIRRMCLKKENLETFLSKRPQRAVEELQE
ELRRIGEQVKSCAVPSFAWERAVIGKNDLIFTAVNQRNAWTGTEVAEYDI
PHYSEEIMRDLLCPSVI
9bace-c9l2p0: Bacteroides finegoldii Putative biotin synthesis protein BioCBacteroides finegoldii DSM 17565 Show
MKQHFIIKNNSKRLLLFFAGWGMDETPFLQIRPTDTDWMVCYDYRSLEFD
TDLLQEYSEIRLIAWSMGVWVASQLMKQYPSLPISHSIAINGTPYPIHET
KGIEPAIFEGTLQGLTEQTLQKFQRRMCGSAAEYKVFQTVAPQRPADELK
EELAAIQQQYLSLPPSDFVWQKAIIGKNDRIFLPDNQRLAWKNKVDILEY
SEAAHYQQELFESIILQTQ
9bace-d0tgf5: Bacteroides sp. 2_1_33B Putative uncharacterized proteinBacteroides sp. 2_1_33B Show
MYIDKIINKRSPSLILCLAGWSTSPELFRHLEVPEQTDLWIAYDYRTLAF
EEAFAPYKEVHLVAWSLGVWVATRLWAGHRSFTTATALNGTPFPMHDTLG
IPTAIFEGTLHHISEEGMRRFNRRMCGDKETFNRYSELSPRPLEEIKEEL
ESLYNQILPEKLESADPRISTFWDQAILSTEDKIFPATNLRNYWQGRCPI
QEIKAPHLPFYHYQSWNELWK
9bace-d0twi0: Bacteroides sp.; Bacteroides ovatus; Bacteroides xylanisolvens; Bacteroides fragilis, Putative uncharacterized proteinBacteroides sp. 2_1_22 Show
MKQYFIIKNNQKHLLLFFAGWGMDETPFLQIHPTDKDWMICYDYRSLEFD
ADILQEYSEITLIAWSMGVWAASQIMKQYPSLPLSQSIAINGTLSPIHET
KGITPTIFEGTLQGLNEQSLQKFQRRMCGSAADYKAFQTVAPQRPVEELK
EELAAIQKQYLSLPPSDFAWQRAIIGKSDRIFLPDSQWLAWRNKVDSLEY
TEAAHYQQDLFDNVIMQIN
9bace-d2f0x1: Bacteroides sp. D20 Putative uncharacterized proteinBacteroides sp. D20 Show
MKQSYIIHEHHPRLLLFFAGWGADETPFKMYRPAASDFMVCYDYRTLDFD
ASGLEEYREINLIGWSMGVWAASQTVPQLSSPGTSGEGIHMANSIAINGT
PYPIDQHMGIPPAIYHGTLDGLTGASLHKFLRRMCANGAAFKAFLEITPR
RPLEELRDELTEIEKMYHTLPAATFHWQQAVTGGNDRIIPPANQLQAWEI
LGTPVLQTEDAHYQEELFRHYLQDLWTSH
9bace-f3phx5: Bacteroides clarus, Biotin synthesis protein BioGBacteroides clarus YIT 12056 Show
MKQVYIINENHPKLLLFFAGWAADETPFKQYHPKDTDYMICYDYRTPDFD
TSVFDRYRQINVVAWSMGVWAGSLILSQVPREKIFSIAFNGSTSPIDNLE
GIPVQTYQATFDGLTPASLQKFLRRMCKDSNAYKAFMEITPRRDFDEIKE
ELRLIRERYFEMFGNMEHKGYDEETEERFQENFERYEYDYDYAFIGSNDR
IFPPENLEMNHDNLMCNNVILTDSAHYDASMFRFLLQDMWEMPIDDFMHH
LKSINIE
9bace-f3pxz1: Bacteroides fluxus YIT 12057 Uncharacterized proteinBacteroides fluxus YIT 12057 Show
MKQTYIIHEHHPRLLLFFAGWGADETPFKTYRPERSDFMVCYDYRTLDFD
KSGLDEYKTVNIVGWSMGVWAASQVVPQLSLPIADSIAINGTPYPIDEHL
GIPPVIFRGTLDGLTGASLHKFLRRMCADGTAFRAFLQITPQRPLEELRD
ELAEIEKMYKRLLPATFHWQQAVVGSNDRIIPPANQLQAWEASGTPARQT
EDAHYQEELFRHYLQELWTSN
9bace-f3zun7: Bacteroides coprosuis DSM 18011 Uncharacterized proteinBacteroides coprosuis DSM 18011 Show
MKPYWTKKENNGSLLLIFNGWGCDENIIQGIDILEYDILILSDYTELDID
LKSLTAPYSVIKVIAWSFGVYVANLYLQELPRVLYALAVNGTIHPIDDNV
GIPSSLFQATLDHYDERFRVKFFRRMMGGNKRLEELAQLLPQRSTEEQRI
ELFEYQQRVEKAQNTICYKWDKIVIGNNDLIFPPSNLINAWKRFDYDCVE
AAHFIPFQKLINQYL
9bace-i9hf19: Bacteroides salyersiae; Bacteroides sp. Uncharacterized proteinBacteroides salyersiae Show
MKQYIYTPSLYTHTAPSHIHTSPPQEPPRLLLFFAGWGMDEHPFLQYAPQ
DSDFMICYDYRTLDFDTSPLTGYTVIDVVAWSMGVWAASQVLSKVSLPIR
RRIAINGTPFPIDEKRGIPPAIFMGTLEGLNEASLRKFQRRMCADGNVFA
RFQLTAPERSIEELKEELAAVAEQYRILPTGTFAWEQAIIGESDRIFPPT
NQRAAWKGISMSNIDGNEAHYDESLFIKYLKEI
9bace-i9rv95: Bacteroides nordii; Bacteroides sp., Uncharacterized proteinBacteroides nordii Show
MNQYIHTSTNQKQDRLLLFFAGWGMDERPFIQYTPRESDFMICYDYHTLD
FDTSSAARYSHIDVVAWSMGVWAASQVLSRIALPVNGSVAINGTPFPIDE
KRGIPPAIFEGTLEGLNEVSLRKFQRRMCANGSAFDSFRHITPQRSAEDL
KEELAAIARQYRELPPASFSWKKAIIGENDRIFPPANQHTAWEETSASIL
HGNEAHYDESLFTQYLK
9bace-k5cjn8: Bacteroides finegoldii Uncharacterized proteinBacteroides finegoldii Show
MKQHFIIKNNSKRLLLFFAGWGMDETPFLQIRPTDTDWMVCYDYRSLEFD
ADLLQEYSEIRLIAWSMGVWVASQLMKQYPSLPISHSIAINGTPYPIHET
KGIEPAIFEGTLQGLTEQTLQKFQRRMCGSVAEYKVFQAVAPQRPTDELK
EELAAIQQQYLSLPPSDFVWQKAITGKNDRIFLPDNQRLAWRNKAEILEY
AEAAHYQQELFESVILQTK
9bace-k9dtw6: Bacteroides oleiciplenus YIT 12058 Uncharacterized proteinBacteroides oleiciplenus YIT 12058 Show
MLFFAGWGADETPFKGYRPANSDFMICYDYRNLSFDSQVLKDYEEVNVVG
WSMGVWAASQVLGKIIADETSKNGRLPLGKTIAINGTPFPIDEERGIPPA
IYHGTLEGLTDASLHKFLRRMCADSAAFRKFLAITPRRPLEELREELVAI
ETAYITGPAYPFNWSTSVIATEDRIIPSENQKKAWTRDERSTPFLAEAHI
LIRIETAHYAQELFEIYLEKEWTND
9bace-r5b9g7: Bacteroides sp. Malonyl-CoA O-methyltransferase BioCBacteroides sp. CAG:927 Show
MTIKPVHISHEPRLALIFAGWGMDERMFMPLRRGGYDIAVAFEYHAPHDL
PEWIDDYKEICIIAWSYGVCMAERTLLTRPQLPVTLKVAVNGTPTPINDT
TGIPEAIYNGTLSGLNERSVYKFYRRMCMNANEFGQWKGMMPRRSLSSLS
EELALFGNIQRTSPVEWDIVFIAGHDAIIPTQNQINAWKGIHDIRMLDCG
HLPDFQSLMNEVLI
9bace-r5c5e8: Bacteroides sp. Uncharacterized proteinBacteroides sp. CAG:598 Show
MKQLYLIHEHHPRLLLFFAGWAADETPFRHYRPQGMDYQICYDYRTLDFD
AAPLRAYAEVHVVGWSMGVWAASHVLPSAGLNVASCTALNGTPHPIDERR
GIPPAIYQGTLDGLTGASLHKFLRRMCADSAAFRRFLERTPRRPLDEIRD
ELACIARLDAELPDATLTWTEAVVGRADRIIPPANQLTAWHELGTPVRET
DDAHYQETLFNHYLQDRWTNA
9bace-r5mer5: Bacteroides intestinalis CAG:564 Uncharacterized proteinBacteroides intestinalis CAG:564 Show
MKQVYIIKDKHPRLLLFFAGWGADETPFKGYQPADSDYMLCYDYRTLDFD
TSLLKTYQEINVIGWSMGVWAASRVMGKLQETDTSLIIKNSIAINGTPYP
IDDTCGIPSVIYHGTLEGLTGPSLNKFLRRMCFNGEAFKEFLNITPRRPL
EELKEELAEIERMYLAQPTTSFHWQQVVVGSNDRIIPPDNQLNAWRKEEE
NNRKKIRVHYTEDAHYQVELFRYYLQDIWTKD
9bace-r5s2a0: Bacteroides sp. CAG:661 Uncharacterized proteinBacteroides sp. CAG:661 Show
MKQVYLIHEHHPRLLLFFAGWAADETPFRHYRPQGMDYQICYDYRTLDFD
TTLLRDYAEVHVVGWSMGVWAASHVLPSAGLNVASCTALNGTPYPIDERR
GIPPAIYQGTLDGLTGASLHKFLRRMCADSAAFRDFLDRTPRRPLDEIRD
ELACIDRLDATLSAPALTWTEAVVGHADRIIPPANQLNAWHELGTTILET
DDAHYQEPLFKHYLQDRWTNN
9bace-r5v778: Bacteroides plebeius CAG:211 Uncharacterized proteinBacteroides plebeius CAG:211 Show
MKQRFIKKEGNSALLLFFAGWGSDEKLFAGPVQEGCDCLLCFDYKDLDFD
YSLLEGYKEIRVMAWSMGVWVACQTLAGKEYPYGMRLAVNGTPFPIHDTK
GIPEAIFQGTLENFSEPVLIRFRRRICGSAAQVKIFLSHHPYREIDDLHQ
ELAALWTAVKARPAVEWIWDKAVVGMNDKIFPPQNQREAWQGVAVEEVDA
EHYDEGLFRELLNGESRLWTRP
9bace-r6d6i9: Bacteroides sp. CAG:754 Uncharacterized proteinBacteroides sp. CAG:754 Show
MKQHFIIKNNQKHLLLFFAGWGMDETPFLQIHPTDKDWMICYDYRSLEFD
AGILQEYSEISLIAWSMGVWAASQIMKQYPALPLSLSIAVNGTPYPIHET
KGITPAIFEGTLQGLNDQSLQKFQRRMCGSIADYKAFQTVAPQRTVEELK
EELAAIQQQYLSLPPSDFTWQKAIIGKNDRIFLPDNQWLAWRNKVDSLEY
AEAAHYQMELFDNVIMQIN
9bace-r6gad4: Bacteroides sp CAG:633. Uncharacterized proteinBacteroides sp. CAG:633 Show
MKQVYIIHENHPKLLLFFAGWAADETPFSHYRPQGMDFMLCYDYRTLDFD
ASLLQGYAEIHVVGWSMGVWAASHVVPTLGLNIGSSTAINGTPFPIDERR
GIPPVIFQGTLEGLTGASLHKFLRRMCADSAAFRDFLSRTPRRPLEEVRD
ELDCIARQYAGQPQPTLKWTEAVVGSNDRIIPPANQLNAWNELGTVAMQT
EDAHYQESLFKHYLQDRWTNN
9bace-r6may2: Bacteroides sp. CAG:443 Uncharacterized proteinBacteroides sp. CAG:443 Show
MKQVFIKKEGNPRLLLFFAGWGSDEHLFRRPVAEGYDYLLCFDYRTLDFD
YSLLDGYREIRLLAWSMGVWVAGQILSGRTCPWEMKLAVNGTPFPIDDQR
GIAEAVFHGTLENFSDATLARFRRRICGGAGQVKEFLSHQPYRTTEELKE
ELAALEHEVGKVLPAAFGWDKAIIGLCDKIFIPTNQRAAWKGTEVMEMEA
EHYDTALFDRLLEGKGEEWTRH
9bace-r6tj08: Bacteroides coprophilus Uncharacterized proteinBacteroides coprophilus CAG:333 Show
MEQRFILREGNSSLLLFFAGWGSDECLFTRPAAEGYDYLLCFDYRNPDFN
YSQLEGYQSIRLLGWSMGVWAASQTFSGKDLPWEMKLAVNGTLTPIHDTT
GIPEAVFNGTLDTFSPATLAKFRRRMCGGTEEVKHFLDRQPRRSVEELHE
ELKTLRQEVLRLPVPAFQWDKAIIGTEDRIFPSQNQLEAWQGTPVLSMNI
AHYADLFFTECLKGKEQLWTKD
9bace-r6zu31: Bacteroides sp. CAG:875 Uncharacterized proteinBacteroides sp. CAG:875 Show
MKQLFIKKEGNPVLLLFFAGWGSDENLFSSPVPEGCDYLLCFDYKNMDFD
YSLLDGYREIRVLAWSMGVWAACQTLTGKDYPYGMRLAVNGTPYPIHDTK
GIPEAIFRGTLENFSEQVLVRFRRRICGSAVQVKLFLAHHPYRTLDDLQQ
ELADEWTMVKAFPVWEWSWDKAIVGTSDKIFPPQNQREAWQGVPVEEKDV
EHYDEELFRQLLSGESSLWTRP
9bace-r7czl8: Bacteroides sp. CAG:462 Uncharacterized proteinBacteroides sp. CAG:462 Show
MKQSFIQQKGSSRLTLFFAGWGMGEGLLASLPEGTDDVMLCFDYRDLQFD
AAPLAAYASIRVVAWSMGVWVAGRVLPSLALPWEHALAFNGTPWPVDDLR
GIPESIFKGTLDNLSEQTLSKFRRRMCGSAPALKDFLQHAPDRSWETLRD
ELAALYEAITRTGPATDWHWDKAFIGTEDHIFPSANQLRAWENLTTQTVH
AAHYDADCIQQLAEGKETLWINH
9bace-r7nqn2: Bacteroides sp.; Bacteroides massiliensis Uncharacterized proteinBacteroides sp. CAG:98 Show
MKQYFIEQRHLPSLTLFFAGWGMDERPFLHYHPADRDLLVCYDYRSLDFD
FSLPEGYEDIRVVGWSMGVWAASQVLDRSCLPITESVAVNGTMTPVDDSR
GIPNAIYEGTLKGLNDVTLRKFFRRMCGSAVLLEDFLTRSPGRSTDEVKE
ELLLIAKQAECLAPARFCWSKAVIGKGDLIFVPACQRKAWSELRVPAEEE
DMAHYSDVFLRDIVCR
9bace-u2caa8: Bacteroides pyogenes Uncharacterized proteinBacteroides pyogenes Show
MYKLTDKKDNIDRLKNDKPMEQLFMIKNNEPELLLFFAGWGMNERPFARI
RPAGCDWMICYDYRSPEFDDTLLQAYSRITLIGWSMGVWAATQVMRRFPD
LPVTQSIAINGTPYPIDETRGIPPSIFEGTLQGLNEQTLRKFRRRMCGSA
DEYEAFADVMPQRTAEELKEELESIRRQYDALPAPAFRWRQAVVGTDDRI
FPPANQLRAWSGTTDVTQTEAAHYSRSLFENLLTNRQITNVHG
9bace-w4us07: Bacteroides reticulotermitis JCM 10512 Biotin synthesis protein BioGBacteroides reticulotermitis JCM 10512 Show
MKQTFLIHQNSPRLLLFFAGWGMDERPFRHYPLGCDWMICYDYRTLDFSV
EELKAYSEIRVAGWSMGVWVASQLATTLATLPVTYRIAINGTTYPVDEQR
GISPAIFEGTLHGLDEANLQKFQRRMCGSANAFKRFQEIVPQRSAAELKE
ELFAIQEGYRTLPRATLRWDSAIIGTSDAIFPPANQQQAWDEQQTTFRQI
KAAHYSEELFTNLFTPLSSEEASDGLLPLLYHA
9bact-a0a0s6vud7: Candidatus Moduliflexus Uncharacterized proteinCandidatus Moduliflexus Show
MKWHWIQQRHNSRLLLFFNGWGMDEHAVAHLECDDWDVLTVCDYRDLDRC
DSPPGRGWGGLSAGNLFTSTPHPQPLPGGEFAVMLRDINYKEIAVICWSM
GVWAYARVSAELQIQPVRVIAINGTPQPIHADFGIAPDAYQATLDHFDEA
GREKFFKRMCGSAALFRRFNQQRPQRGLAEQAEELAAIQAASVVAKERIP
LLGGELIALISAHDRIMPTANQQRYWEGRAQCVLLDAPHYPFFLWKRWAD
ILTIF
9bact-a0a1b1fp56: Flammeovirga sp. MY04 Biotin synthesis protein BioCFlammeovirga sp. MY04 Show
MQYKWLKKENSASITLFFSGWGQTPAYFQDFQLDDADVLMLYDYQSLDFS
EINSLCNAYNNVNCISWSFGVLVGAHFLLQNDINGERIAINGTLSPVDYT
FGIPPAIFKGTLDGLSETNWKKFIFRIFPDRTMASQFLEMPHRSIDQLKK
ELKFLGEVNSIEDHTLYQQAFISNSDRIFPYQNQINAWESSEHTVIDGAH
FPFDKITFLSKFKTNSNAYDSVR
9bact-a0a1d7ys44: Candidatus Melainabacteria bacterium; Clostridium sp. Uncharacterized proteinCandidatus Melainabacteria bacterium MEL.A1 Show
MQFHWLNKQNNDKLIIFFAGWSFDEQPFKFLACDNYDVLIMYDYTSLDCE
IEDFSQYREINLIAWSMGVFTAYLLKDNLPKFNKKIAINGTPLPVDDKYG
IPTKSFLLTLRHAKTGLEGKFYQNIFDKPEEFEKYTKTPVTRSIENRENE
LKSLYTQIKNTTINYVHFYDKAYISKFDKIIPTKNQINFWQNNAKIEILE
SGHFPYYNFKSWKEILCK
9bact-a0a1f3d7h8: Bacteroidetes bacterium GWA2_40_15 Uncharacterized proteinBacteroidetes bacterium GWA2_40_15 Show
MRTYIRRREKNNQLVVFFGGWGSDENMFIPLCTDEFDFIMFYNYSADEAL
VLPETKTYERITLIGWSLGVWAAEYLTSKTGIKPDISIAINGTPLPAHDQ
YGIPLNIFEGTLNNLTEENIEKFYLRVFGDKKTYLINADRVPKRTIKSLH
DELRWLYNRIMEQKEPGFNWTYAVSSEKDRVFPAKNLKSYWEREEDTKHI
ILPLPHYFFHNWSSFTSFISFVENYIPDNKKRSVKPVKKSKGL
9bact-a0a1f3lc08: Bacteroidetes bacterium GWF2_35_48 Uncharacterized proteinBacteroidetes bacterium GWF2_35_48 Show
MSKMKSTWINKKKNNRLILFFNGWGMDEKAVSNLDCENNDVCMFSNYDSS
IVNFASDFSEYEDINIVAWSLGILAAEFFMNNNTKKITKSIAISGTSYPA
HDDYGIPVQIFNGTIANLSVESLKKFQRRTCGSKENYERNQHIFNQKNID
DKKKELETILKLQTFLPTEKNTWTQAIICTGDLIFPVKNLENYWSSRLTP
VYIESPHYPFNKWKSWEEVLESVASTPLSHRKSQPLTISLKPKKYK
9bact-a0a1f3mxs4: Bacteroidetes bacterium RBG_19FT_COMBO_42_10 Uncharacterized proteinBacteroidetes bacterium RBG_19FT_COMBO_42_10 Show
MKTYIRRFERNDQLVVFYGGWGTDENVFTPLCNDDFDFILFYNYSADEAL
VLPEMKVYRKITLIGWSLGVWAAEYLSLKTGIKPNLTIAVNGTPVPADDQ
YGIPLKIFEGTLNNMTEENMEKFYLRMFGDKRTYRMNADRIPHRSIKSLN
DELRWLYNRIMEQTEPGFRWDYAVSSEIDRVFPSENVNSYWKKEKSTRHI
VLPLPHYLFNRWNSFSEFINFVEQFRKKRATGRKKEETVIKDL
9bact-a0a1f3n6t1: Bacteroidetes bacterium Uncharacterized proteinBacteroidetes bacterium Show
MKTYIRRREKNEDLIVFYGGWGTDENVFAPLCTDNFDFILFYNYSADEAL
VLPETKTYNSITLIGWSLGVWAAEFLSERTGIKPDLAIAVNGTPVPAHDR
YGIPLKVFEGTLNNITEANMGKFYLRMFGDKKTYLRNIDRIPHRSLKSLN
DELRWLYNRIMEQKEPGLRWDYAVTSEIDRVFPARNLNNYWEKEKGTIHI
VLPLPHYFFHEWHSFPDFVEFVRNYRKAGAKHKRTVRSPDKFLTS
9bact-a0a1h6mas1: Akkermansia glycaniphila Alpha/beta hydrolase foldAkkermansia glycaniphila Show
MQQHWLNRSNSGKLIIYALGWASTPDAVAHIHTPDYDILCLYDYRSISPL
TPEDFSGYSHITLFAWSFGVWVSERIASGLPLARAIALNGTPLPVSDEYG
MRLRVVLRTMQGLKRVGMAPFNEKTYGGLENMPALQYPDRSIDEKIDELN
YLAEQAKADSTPIIPWDKAYIADQDEIFPPAKMEAYWHSRGLGTPFHAYH
YPFADPAIVLNELPE
9bact-a0a1m3fuj9: Bacteroidia bacterium 44-10 Uncharacterized proteinBacteroidia bacterium 44-10 Show
MKQQFIVNENRPGLLLFFAGWGCDENLFAESAPFGYDYMLCYDYSSMDFD
FSVLANYQSIRLMAWSMGVWVATKTFLDKPFNWEMKMAINGTLSPKDDCN
GIPKVIFEGTLNQFSANTLSRFRKRMCASSQQAELYSSRTADRSIESLKE
ELTTLNREIDRSAEKKLSFTWDKIIIGRQDLIFPFKNQMNAWAGHNFELR
EMPHYDASFFTLCIQGEDSLWTRH
9bact-a0a1m6vzk9: Fibrobacter sp. Biotin synthesis protein BioGFibrobacter sp. Show
MRIKQLTPDRENRPLALIFLGYAFTPECLSSVDFGNYDVSVVYDYQTLEF
EDLMAWEKIQNSKREIFLIAWSMGVWAANRFASGLEFQKAVAINGTPFGI
HENFGIPPGTFQNSIEHFDFELFKKWCFLNDRAQAHFAFSDHPKIELQTL
FKASKNVAQNRIRWTKAIVSKKDVVFPPKASSCFECPVQTILAPHFPFFK
MNSLEDIFAI
9bact-a0a060r645: Mucinivorans hirudinis Biotin synthesis protein BioGMucinivorans hirudinis Show
MQIDWIVKNGNDKLLVVVLGWAADPTMVASVVELRKDFDIVCIYDFREIR
SLDTLGNYPEIHLIAWSYGVWAAEQILPEMDFASAVAVNGTPLPVDDEFG
IQKKIFELTVNNINISKFEQRMCFGMRETVKIRRPENECIDELRALQKYF
QNPYKVSIKWSKAVVGGRDLIFPPEKQLKYWNSNNTEVDYRQNAPHFIGI
9bact-a0a133xzl9: Bacteroidales bacterium Uncharacterized proteinBacteroidales bacterium Show
MTFQFLSKKQGNKKLLLFFNGWGMNEAAIGHLVPPEGYDILVAYDYRDFT
SFPHEVEQYESILLVAWSIGVWAVEQLRQRGLLPKVKYSLAIAGSPFIRH
NRFGIPCKVFDLTLQSLNDSSREVFNRRMCGGKSNAALFKEFEKRETEEL
REELNTVREIELARQEERPLFHWNRIFIAQKDKIIPPQNLFTLSQSYGIP
QDSFPDASHFLFQDFQYWQELLDRLS
9bact-a0a150aie5: Flammeovirga sp. SJP92 Uncharacterized proteinFlammeovirga sp. SJP92 Show
MQTHWLNKKDSDSVIIFFAGWGQSRHYFEQNLTSEKDVLMVCQYENLDFN
SIIEAITPYKEKIVIGWSFGVLVASRFMETYSDYNYSIAINGSLKPVDDT
EGIPTAIFNGTLQLLSQKSWEKFAFRMIGDRLVYTSFIENNDREIDSLKE
ELAFLGQCESPSKTVTFDQVLVSQKDRIFPSDNLMNSWIAKGITPQLIDT
HHFPFHHYHTWESIGQLNQTLSL
9bact-a0a177e5h1: Thermodesulfatator autotrophicus Uncharacterized proteinThermodesulfatator autotrophicus Show
MKFRFIKRKGEGLLIFFLGWSLDERPFLPLMEKEHFDVCFIYDYREDKLP
SFPEYPETIVLAWSAGVIFALSYQEKFNKLTLCGGTGFLRHSKWGIPPKI
YDATLLALKKDGEKALLSFYRNLFWREEDFNFFIKNRPRRPLTEIIEELE
VLKEKSFSGKPKHARILVTEKDRIIPARNQKNFWNYVGLSFTLKPWEHFP
FYRAKTLSSFCLT
9bact-a0a179d671: Thermosulfurimonas dismutans Biotin synthesis protein BioGThermosulfurimonas dismutans Show
MRLALLGNLEAEELIVFFAGWAMDERPFHGLCGEETAVAVLYDYRDLELP
EIPKGYSRVYILAWSLGVYAALKNLSSLDGEILFLAGTGAFSHPEFGIHP
RVMNLTLKGLEERREKSLLAFYANMFSGELGLEIFLENQPQRNLSEVVEE
LKMAAERGPLFPSNFSKVRAVCTLRDRIVPFEAQLRYWERVGVPVRTLEA
GHFPFYRFSSLKELFFREDV
9bact-d1n3e0: Victivallis vadensis ATCC BAA-548 Putative uncharacterized protein, 1 reference(s)Victivallis vadensis ATCC BAA-548 Show
MNAAFIRQNHTPVLELFFNGWSMDDCVAHALAGADDLLAVWDYTSFDLDL
LPLLAGYREIRLTAWSLGVWSAAKYFENKEVAFADAVAVNGTLQPVSAEY
GIAPDIFAGTAANWLEERARERFNLRLAGGRAELAAFPGSGRSAESQQNE
LNSLLHNIMESLIPANLFRLAVIGSRDRIFSPAAQRAAWQMTESRIVEID
SPHYPFALYPEVAELGKLG
9bact-f3qq57: Paraprevotella xylaniphila YIT 11841 Uncharacterized proteinParaprevotella xylaniphila YIT 11841 Show
MKQTFIKKEGNPRLMLFFAGWGSEENLFRRPVEEGYDYLLCFDYRTLDFD
YASIKGYTEIRLLAWSMGVWAASRVFAERSFPWQMKLAVNGTPFPIDDRQ
GIPEMIFKGTLEHFSEDTLARFRRRMCGSSGQTEEFLSHAPTRTAEELRE
ELAALAQVITTCAAPSFTWDKAIIGNRDKIFPPRNQHKAWQGTEIMETEA
EHYDTPLFSRLLEGKGEEWTRH
9bact-g5hak8: Alistipes indistinctus YIT 12060 Uncharacterized proteinAlistipes indistinctus YIT 12060 Show
MEQHWIVKERNRDLIVFALGWASDFHAVAHIRPEGYDILCTDDYRTIESV
DPATVAGYRRIYLFAWSFGVWVSELIFRGIPFYKTVALNGTPLPVNNRYG
IPPKSFAVTLKGIAHTGIEAFNRRTFGDFYDTIAPWLETRPFEEKYEELC
NLFDASAKAYRPSITWSEAVIGLQDIIFPPDNVKAYWTEESPATEVQLCP
GMPHYPYADPAIVLSRLHTEQPMQSRRHER
9bact-g5smt4: Paraprevotella clara YIT 11840 Uncharacterized proteinParaprevotella clara YIT 11840 Show
MKQTFIKKEGHPRLMLFFAGWGSEENLFRHPVEEGYDYLLCFDYRTLDFD
YTLIEGYTEIRLLAWSIGVWVASRVFTGHSFPWQMKLAVNGTPFPIDDRR
GIPEMIFKGTLEHFSEDTLTRFRRRMCGSSRQTEEFLSHTPTRTAEELRE
ELAALALGITAYGSSSFIWDRAIIGNRDKIFPPRNQHEAWQGTEIMETEA
EHYETSLFSRLLEGKGEEWTRH
9bact-h1dfd5: Odoribacter laneus Uncharacterized proteinOdoribacter laneus YIT 12061 Show
MRIEWLVKNNTDQVVVFFNGWGMDKRTFPRLEGEMDKIVCWDYRTLNTDS
TPSFIGYKKINVVAWSMGVWAAANILPEWGIQPGHLVAFNGTERPVDNRW
GIPSPVYLLTEKRMNEKGREKFFSRMFTCQKEQEEFFSCRPERELAGQIQ
ELQAIRTQCEKYQHTLEWERAYVSEKDLIFPVENQQNWWEKRGVPTESLP
TAHYPFYFFRTWEDIWKSKD
9bact-r5am74: Prevotella sp. Malonyl-CoA O-methyltransferase BioCPrevotella sp. CAG:1031 Show
MKQTITQRGYDRLLIVFAGWGCDAAAVGEISAEGYDTLVVSDYRSQEFDD
SRLAPYSEIAVIAWSFGVIAAARFLAERPALPLTLAAAVNGTLHPVDDTL
GIPRAIFDGTLDALDERNLMKFYRRTGFGAESAAIAARMDIDALRDELRA
IDGLTGPLFEAWDIAFVSTDDRIIPTENQRRAWEMTSTPVVTLDTPH
9bact-r5ggq3: Prevotella sp. CAG:755 Uncharacterized proteinPrevotella sp. CAG:755 Show
MKQVFLRHEGQPRLLLFFAGWGAEEALFDPPTMQGHDCLLCYDYRSASFD
ASLLAPYAGIRLLAWSMGVRVAADTLAGLSLPWERRLAVGGTMTPVNDER
GIPEATFRATLAGFSGQSMLRFRRRMCGSSAESARIAALPLHRRLDDLRE
ELDALWRRVEKSPAPAFNWDAALIGTSDRIFPPENLRRAWAGVPQTERPT
AHYDRALFHELLSEETLWTNA
9bact-r5i6a7: Alistipes sp. CAG:831 Uncharacterized proteinAlistipes sp. CAG:831 Show
MKHVFLRQSEGASGLLLFFSGWGAEPCMFREGATDESAAYDILMLWDYRD
MSFDARILSGYKEVRVLAWSMGVWAAGQVLSQPGLNGCANGMRLAVNGTP
FPIHDRMGIPEAVFDGTLASLSDRTLGKFRRRMCGSTQALEQLLSCGLTR
STDELRDELSAIREAVRHGADHDADTSSPFHAVIGSGDLIFPAANQTEAW
KGLDVPVSLLNIPHYDSSLFRKLLYKEDSWTNI
9bact-r5n968: Paraprevotella clara CAG:116 Uncharacterized proteinParaprevotella clara CAG:116 Show
MKQTFIKKEGHPRLMLFFAGWGSEENLFRHPVEEGYDYLLCFDYRTLDFD
YTQIEGYTEIRLLAWSMGVWVASRVFTGHSFPWQMKLAVNGTPFPIDDRR
GIPKMIFKGTLEHFSEDTLARFRRRMCGSSGQTEEFLSRTPTRTAEELRE
ELAALAQGITAYGSSSFIWDRAIIGNRDKIFPPRNQHEAWQGTEIMETEA
EHYETSLFSRLLEGKGEEWTRH
9bact-r5pbd3: Odoribacter sp. CAG:788 Uncharacterized proteinOdoribacter sp. CAG:788 Show
MRIEWVKQHTGGRVVVFYNGWGMDNKAVSQLRTDCDLLICSDYRSLELPF
LPDFSDYREIYLVAWSMGVWAAANTVGKLNISPRCNIAMNGTEYPVDDNL
GIPCRIYALTERGMNIQGRDKFFCRMLDGAEDAERFVSNRPCRDLPEQVE
ELCLIRTQSAVYKNNLKWDKIFVSEKDVIFPVMQQMNWASGKAEIKKLRG
GHYPFYNFQSWEDIINF
9bact-r6f3x7: Odoribacter splanchnicus CAG:14 Uncharacterized proteinOdoribacter splanchnicus CAG:14 Show
MRIEWLNKKGSGRVIVFFHGWGMDAAGVSHLQMEDDVLMCYDYRSLDFDF
PDLGHYRCIYVVAWSMGVWAADRVISRLEMKPERCVALNGTTRPVDDEYG
IPVKIYELTEKGMNERGREKFFLRMLDGADECRKFSGQKPNRGIEEVCEE
LCRIRELCSGVKGNLNWDKSYISEKDSVFPAQNQLNWCRKEGIPAVSLPG
GHYPFYRFRSWREILGK
9bact-r7j1x6: Prevotella sp. CAG:873 Biotin biosynthesis protein BioCPrevotella sp. CAG:873 Show
MRYKFISRENNNRLILIYAGWGMDWRVFRHMRRHGYDIIIVWDYRQLTFD
WSVVASYDEICLVAWSMGVFAASVTIHEILPRITKSIAVGGTPDPISDTL
GIPVEIYRGTAEGLNAGNLRKFHRRMCLDAGHYSAFREVAPRRDISSLRD
ELYALETHTIFHAPQVCRWDLAIIGRHDRIFPPANQMRAWRDKAPTVITE
GAHLPDMQSIIDDYIVD
9bact-r7p862: Prevotella sp. CAG:617 Uncharacterized proteinPrevotella sp. CAG:617 Show
MKYQYIHQHEGARRADLLMAGWAADEHLFADLPDTGDDLIVCYDYSNLTL
HTAGWPEYEQVRLLAWSMGVWAAEHTPALQGLNLTDCLAVNGTPRPIDEH
CGIPPRVFELTLRGMSGAALVKFRHRMCGDTYAYFMRHLPQRSLEDMQHE
LATIGRQALSLPEGRLPWTRALVATADVIMPTANQQQAWQERGVRVCMTE
GAHYAPQYFEEWRSRR
9bact-w1i648: environmental samples uncultured bacterium Uncultured bacterium extrachromosomal DNA RGI01476uncultured bacterium Show
MNYKFINKDIDNNAILFFAGWGMDKNPFLWAKNLPLDFIVIYDYSNFELE
LDLSRYKNIYVFAWSFGVYAASKWMATSERPILSVAINGTPKPIDNNYGI
PVKIFKGTLDNLSEMSLQKFNKRMCGLTNLKVFNANKPNRSIASLRNELV
AMDEANKQNIEPYNNWDKVFISGKDYIFPTENQKRFWNETNAVTIDLEDD
FHFPNDFQTIIESCFIDKESRRPCYVVMRIKIAFSPSKRIF
9bact-w7y0l6: Saccharicrinis fermentans DSM 9555 = JCM 21142 Uncharacterized proteinSaccharicrinis fermentans DSM 9555 = JCM 21142 Show
MTKKWRIRNKYENVILFFNGWGMDHSAVDHMQSDHYDLVEFNDYRTIDFN
ECEYSHYEKIYVVAWSLGVWVASFIFNRSSLAISKAVAINGTPHPINAKE
GIRPSVFEGTLKGWNKSNRELFLMRTIGAKSKYEAHATIFGKRTIENQKE
ELASLYKQINVHKDFEFKFNTAIIGNDDAIFTAQNQVNYWQSKTYCKFMD
LPHYPFLQLLSWDVILRL
9burk-h3kep4: Sutterella parvirubra YIT 11816 Uncharacterized proteinSutterella parvirubra YIT 11816 Show
MTVTLLRGGVSAASASSNASSTVSSNASSNASGPITIFFAGWGMDETPFA
SWRTDAAMPGTLILVDDHVMENHPVLHWILEQKLSATDDGSEQPALHIVG
WSFGVRAAADWLDRAFENPDLRELLSARKVVLSFVAGTLLPVDRTYGIPP
AVAALTQKTLSPESAATFRQRMCGESAENNPFVLTPPVRTVESLARELSF
FRTLPAPTDENPAAALARIAESLPALSITAHAAGKDAIVPPAAQERFWTK
AEELLGKEKLTVRTHPDAPHGDFDLLTQIVRGNA
9burk-i7ic83: Taylorella asinigenitalis 14/45 Uncharacterized proteinTaylorella asinigenitalis 14/45 Show
MKRRLIKGAGPSERLILYFAGWETGPELVEHLVVPEGFDVLCLWDYRTVD
EGVGIATGYKEVHIIAWSLGVLMANTLCANKSISSACAINGTLRAIDSEY
GLDPQLYLDMMHSLDEVQLQKFNKLMCLTKESLYFFEARNLRNLNEKREE
LEAIYEVAMGKQGNPIKWTRAIVSDKDYIFPSRKQLASWQCSRNTLIDSN
PYGHMFFDKVNSWSELLG
9burk-i7izb6: Taylorella equigenitalis Uncharacterized proteinTaylorella equigenitalis 14/56 Show
MKKRLIKGAGPSERLIIYFAGWGTGPELVDHLDVPEGFDVLCLWDYRTVD
ECLDIATCYRDVHIVAWSLGVIVADAHCAHISISSACAINGTLQAIDSEY
GLDPNLYHKMMLHLHQDQLYKFNKLMCRSLDSHRFYCDRDLRNLEDKRAE
LEAIYHLAHCRQGSHINWTRAIVSDKDFIFPSRKQLLFWQCFRNIRIDSN
PYGHMFFDKVNSWSELMG
9burk-v8g951: Pelistega indica Uncharacterized proteinPelistega indica Show
MKTEFVNHQGEHLLVYFAGWGTPPSIVKHLKLPDHTDLLICYQYHDLICN
FNFTVYQSIRVVAWSMGVWVAERVMHNYKLLSATAINGTGTPCHAQTGIP
PHIFQRTLNKLSPQTRHYFEHRMCLDKTTLSDYIQRQDYREFEDIRTELH
FLSSAITNDTQKDLITWQNAIISRNDSIFPPVNLYRYWENRCKVIEYPYA
HLLFHHFTEWKNFWEMMYD
9chlb-a0a1b1q548: Prosthecochloris sp. CIB 2401 Uncharacterized proteinProsthecochloris sp. CIB 2401 Show
MRTEWLLHSARRRVVVFFNGWGMDHGIARHLLANTPEGFGYDLLSCYDYG
DPRLAPDTLTELGQYDERIVVAWSLGVWAAALSGIEGVSRSLAINGTLTP
LDRKQGIRPDIFQATLDGWSEKGRERFNRRICGSNESLELLQQMGVQRDI
ADQKRELEAIFSTLSHSTSATGYASWGFSR