Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Esterase_phb

Esterase_phb


Genes:Proteins in Esterase_phb (80)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9alte-a0a0d3mcx9.1: Alteromonadaceae bacterium Carbohydrate esterase family 1 domain-containing proteinAlteromonadaceae bacterium Show
PAAFAASLSQVSNFGNNPSNLDMHLYVPDNVQSNAPLLLAVHYCTGTGPE
FFQNTSYNNLADTYGFIVIYPTATRSSKCFDVYSSSALTRDGGSDPVALM
SMVNYVQSNYNVDANRIFVTGVSSGAMMTNVMLALYPDVFSAGAAFAGVP
YTCFATTGSSEWSGECANGNITKTAQAWGDAVRNANPGYGGERPRIQLWH
GTNDETLNYNNFNEAIKQWTNVHGLSQTPTFTDQPSANATRTRYGSSGAN
AQVEAISLQGVPHNLPVEEEEAIRFFNLDDSTPP
9bacl-LtPHBase: Lihuaxuella thermophila Esterase, PHB depolymerase family LtPHBase, 1 reference(s)Lihuaxuella thermophila Show
MMRGKNGLFRWMFLLALVTSLIGTGMFTTPVHAAGQFIRDTAPDGRVYKL
YIPSGYNGSTPLPLVVMLHGCTQNPDDFAAGTEMNVYAEQNNFLVAYPEQ
PSSANLNKCWNWFDSNHQSRGRGEPASIAGVVEDVKRNYSVDSRRVYAAG
LSAGGAMSVIMGATYPDVFAAIGVGSGLEYKAATSMTSAYMAMINGGPDP
VQQGNLAYQAMGSHARVVPVIVFHGTSDYTVYPVNGHQVISQWAQTNDRA
GDGVDNNHIDDQADVTMNGSVPNGRTYTRYLYKDQNGNVVMEKIMVNGMG
HAWSGGSTAGTYTDPAGPEASSMMWSFFVNHPK
9bact-d8v1i8: uncultured bacterium Esterase/lipase EM3L4, 1 reference(s)uncultured bacterium Show
MTGRIGRIILVVVVAIVLVLCIAAMVTYWMVGPTPRCALPAEGPSGPGWS
ARTLDSGGRERCYHLYVPPGYNPAQPAPVVVSFHGFLSNPNSHALISGWH
KLAEQEGFLVAYPQGTSFPLRWDAGSTWGAPGVNDVQFFRDMVDDMANVA
AVDRSRVYVNGFSNGGGMAVRIGCEAAGEVAALGSVAGAVVEIEECSPSR
PVPVMAYHGTADPVVPYEGGEMQGWLLRWGAGAVDAPVYFVGAEDWVSLW
AAGNGCDPTPDVVPAQGDASGIRYTGCDQDAEVSLYTIDGGGHTWPGGWP
IPAVGKTSTDINATGEMWQFFQRYQLEEQP
9bact-estC55.77: uncultured bacterium. Lipolytic protein estC55-77, 1 reference(s)uncultured bacterium Show
MAPDLELYAGAGSASERTLLVDGELRTYRLFVPASAEPGRPVPVVFNFHG
LGSSAREQELYSQLVPLAEREGFVLVSPQGVGEPARWRGAGISQEDGVEG
PDVRFFDRLLEFLADRLCLNPQRVYVTGMSNGAFFSSVLACYRPDVVAAA
APVAGVYFPPGGCRGPVPLLAVHGRLDQVVPYGAGLIFGVIPYRGAEAYV
AEWAEQNGCRERTVRRLAPHVLELRYEGCAADTALLAIEDGGHTWPGSAE
VPRLGPTNQEVSAAELIWEFFERHPRSP
9brad-q358e3: Bradyrhizobium sp. BTAi1 polyhydroxybutyrate depolymerase precursorBradyrhizobium sp. BTAi1 Show
MRPHGLLMFAVIAMLASAPALAVDRDMVIDTADGPRHALVIPAPSGPRPT
VIVLHGALGSGAGTARTAGFAEAAARRNFTAVFPDGLDRQWNDGRMDGHN
GPDDIGFIRALVRRLVADGVADPHRVYLAGISNGGMMSFALACKAPELFA
GIGTIIANMPAGVEPCTARPMPVVMINGTADPMVPYRGGEVGLRGGRGLV
WSAETTAAFFARRDGCDAQRMVALPHRDDTNGTSVTQISWQNCKVTGGVS
LYRVEGGGHALPGRRALAPRLLGPSNFDIDSAETILTAFDRDGAL
9brad-q358r1: Bradyrhizobium sp. BTAi1 esterase, phb depolymeraseBradyrhizobium sp. BTAi1 Show
MLDQDIMREATRLTRAGQLIEATALLQRMLRGAGAPAAASSAAARPAPRR
LSAPTIDGEATRIGERARSAAPDAAAQVRTAERTAAQDSDMPLRGASALA
RKRFVRRDGLRDLPGIGLRGPALRMPAAHEIAPEGARFIQRSFSNAAGHR
SYKLLIPSRTHGHPLPLIVMLHGCTQSPDDFAAGTRMNFAAEAQGCFVVY
PEQPSGANPSRCWNWFRTGDQQRDGGEPSLIAGITRQVMQDHAIDPKRVY
VAGLSAGGAAAAIMAATYPDLYAAAGIHSGLACGAARDLPSALMAMRQGG
AAPAAARSAVVPTIVFHGDRDTTVHPANGDQIAQSTNGRGTASVARGRVP
GGHAYTRTVLTDRGQVTSEHWIIHGAAHAWSGGSPAGSYTDPNGPDATRE
MLRFFLAHARG
9burk-TanHcw: Herbaspirillum camelliae; Herbaspirillum sp. WT00C tannase Tan Hcw plasmid partitioning protein, 1 reference(s)Herbaspirillum camelliae Show
MTIRLLSRLRPFHLLGPMPRLVRLYRRGRMACLLGLALGAAALSPAQAVD
LSLKTIRVGNLSRAYFSERTSVGEARPLIIALHASGSSGSLMARATGLTE
IAEAAGYMIVYPNGTGLAIDARTWNSGGCCGYAQMHKVDDVAFLRALVEK
LAKDGLADPQRVYLVGVSNGGMMAYRMAAEAPGLFKAVAVVSAVLDVSPE
TVKAPMPVLHIHGSEDPFIPFLGGIGKQEVSQLPRISVARTIETWVKANG
AEPRPAVTDIPDSANDGTTIRQYTYRSKTDPQSVVLYEVKGGGHAWPGAV
IPIVNGGKSSQNMDASRTVVDFFNAHGGGRSDEPADENLPPGAKPLPAAT
PAPAVAPTPPPSPTRPAR
9cory-c6rbr0: Corynebacterium tuberculostearicum SK141 Putative exported esterase/hydrolaseCorynebacterium tuberculostearicum SK141 Show
MLGAVTVCFLAAAGTSCSSESTESPHAAETTNTVNLGIPTSAPLNGPEPG
SYRTINLPSGRSFILSVPKDYTGDKKWPIVLAFHGWGQSAENLRGYSRLD
AADAIMIFPEGKKKAWSPAPYAKTSTTEDKKFVREIIDAVRATYHVDDGR
IFATGMSNGGGFAAYLACQMPDTFKSVATVSAAYYEDILKNCAHSPVGRL
DMHGTVDPVVGYYGGTRHKTKYYSVESVLEQDRKRNGCSTKVDTTRLVNN
ALDMRWSGCTAPLEHIRIAGGSHVWPGGTADAHNEVGRFFATDRVLDFFG
IPGRPSGTAQT
9euro-a0a1l9u6p8: Aspergillus brasiliensis CBS 101740. Uncharacterized proteinAspergillus brasiliensis CBS 101740 Show
MLSTHLLFLVTTLFTSLIHPISAHVAKSSSSLQQVTDFGDNPTNVGMYIY
VPNNLASNPGIVVAIHYCTGSGPAYYSGSPYATLSEQYGFIVIYPSSPYS
GSCWDVSSQATLTHNGGGNSNSIANMVTWTISKYGADSSKVFVTGSSSGA
MMTNVMAATYPELFAAATVYSGVSAGCFYSASNQVDAWNSTCAQGEVITT
PEHWAQIAEAMDSGYSGSRPKMQIYHGSVDTTLYPQNYYETCKQWAGVFG
YDYSAPEKTEANTPQTNYETTIWGDSLQGIFATGVGHTVPIHGDKDMEWF
GFA
9euro-a0a411dz87: Talaromyces leycettanus JCM12802, Aspergillaceae incertae sedis Acetylxylan esterase, 1 reference(s)[Talaromyces] leycettanus Show
MGQLSILLTLLFYIAFSSAVAVDHDGARLARRITRGSLQQVTNFGSNPTN
VGMYIYVPNNLATNPGIVVAIHYCTGSAQAYYSGSPYAQLAEQYGFIVIY
PSSPYSGTCWDVSSQAALTHNGGGDSNSIANMVTWTISQFNADTSKVFVT
GSSSGAMMTNVMAATYPELFAAATVYSGVPAGCFVSSTNQVDAWNSSCAQ
GQVIDTPAQWASVAENMYPGYTGPRPRMQIYHGSVDTTLYPQNYYETCKQ
WAGVFGYNYDSPQQTINNDPEANYQTTIWGPNLQGIFATGVGHTVPIHGT
QDMEWFGFA
9pezi-a0a481sy08: Thielavia terrestris thermostable carboxyl esterase 1 protein, 1 reference(s)Thielavia terrestris Show
EEAEAEAEPKASLQQVTNFGTNPTSIQMFIYVPAKLAANPPIIVALHPCG
GSAQQWYSGTKLPSYADSNGFIIIYPQTTRYSNCWDVNNAGSLTHGGSGD
ALGIVSMVNYTLSKYNGDKTKVYAMGASSGAMMTNVLAGSYPDVFEAGAS
YSGVAFACFAGSTSPPTPFGANQTCAQGLQHTPEEWAAFVHNAYPGYSGK
RPRMQVIHGLADTLVRPQCGYEQLKQWSAVLGLTNTRNVTGSSVPEGAQY
TEIVYGDGSQLVGYFGQGVGHFAPPNEPVMLKFFGLL
9zzzz-a0a0g3feh5: uncultured organism EH137 Uncharacterized protein, 1 reference(s)uncultured organism Show
FTLDDSPVGDMEYYLYDPVAHGADPGKKYPLIVMLHGASNGMEGVMCAAY
TDFVVYAGEEYQQKIGGAYILFPKANEYVQMEGDNQVILGTWMTRDATQE
GSVYTSVLAALLEDVISAHNIDEERVVIGGTSAGGYMAWRFLAARPDLVK
GAFLIAPADNPSEEELKTYEKHGIHIWVIHGKKDEICPFGVFTGPVRNML
EATKNVRVSALETVRYGDKGIVRLNVRGTEMGQHLPLFCVGSDMIYDDGT
PYDPRYPEGFTGWLNMVFGND
acrth-axe1a: Acremonium thermophilum Carboxylic ester hydrolase AXE1A_ACRTH, 1 reference(s)Acremonium thermophilum Show
MHLASAAATLVALFAAAARGQGITKVNDFPGTPTKLGMYVYVPKKLATPA
PIVVGIHHCQGSAQGYSTETHYQPLADQHGFIVIYPNSKSGGGCFDVAST
ATLTHDGGGDSQTIANMVKYAVEHYGGDANRTFATGTSSGAMMANVLAGA
YPDVFKAISVYSGVPDGCFYVAGSTATQDPPGWANACANGQLTKTAQQWG
DLVRSYYPGYTGPRPRMQIWHGTADTTLHYPNYQEQLKEWSNVLGLNTSK
TAANTPQSGYTQTIYGDGTATTAELVGYSAQGVGHTVPVHESMDIAFFGI
SS
agrtu-ATU2409: Agrobacterium fabrum (Agrobacterium tumefaciens, Rhizobium radiobacter, Agrobacterium radiobacter); Rhizobium sp.; Agrobacterium sp. Polyhydroxybutyrate depolymerase atu2409, 2 reference(s)Agrobacterium tumefaciens Show
MSMHQDFATGRAARLFRSARTLVLGLAMCASAGVAASASTCGQLPGPGME
PGRHDFSILSNGEKRDGVYFVPSAYDGKKPLPVVFDFHGSNSNPHGQLNR
SGWDKLAERDGLMVVALAGSLNGELPGTHAWNVPGVTKRPGGLDEVGFIR
DAITMVKGKFCVDEERFYGSGYSGGGRMLSQFICSGNADFNAAGFVASLR
AGYPLETEGRWGPDAASCKPARPMSIIAFAGLKDPANPYQGGGKSYWQYS
GETALKRWAEMDGCKGGAKTKPGESFTVNSYDVCKAGARIQSYVIENWDH
AWPRATMKAEVLAASAVVTRKPGGEQTPKAEPAVERKMPTGEVTRTVDAA
ERMWDFFRNTEGQMVVDAVVKKDCGTKANSASASASETACSQNSKPSALP
VVKTLNNLSGSSAPVAEDAL
alcfa-PHAZ: Alcaligenes faecalis; Alcanivorax sp. ALC24_4101 poly(3-hydroxybutyrate) depolymerase, 1 reference(s)Alcaligenes faecalis Show
MTSRPMRSLVIAFLTLVAAAAPALAGAGAWQNNLSLGGFNKVHLYTPDGD
SPVGNGKALLIVLHGCTQSIDAYKTANLEVAAEEYGMVVAVPDAMNKAGF
SCWSYWQGTKSRSAGDYKNLINLANTLSGDAARGIDPNQVYIAGLSSGAS
FANTTACLAPDVFAGVGVSAGPSVGTSSSGAIGTCEQADVESRCRDLGGG
YQSAFDTQVASIAHGDADTTVDTCYNRQNAEGMAGLYGVSEVAGSTVINA
DGGSAEEFLWQDGRVSMLWFHGLDHSWSGGQGASGSYVSGASINYARYLG
GFFAEHNAR
alcfa-phb: Alcaligenes faecalis depolymerase, 2 reference(s)Alcaligenes faecalis Show
MVRRLWRRIAGWLAACVAILCAFPLHAATAGPGAWSSQQTWAADSVNGGN
LTGYFYWPASQPTTPNGKRALVLVLHGCVQTASGDVIDNANGAGFNWKSV
ADQYGAVILAPNATGNVYSNHCWDYANASPSRTAGHVGVLLDLVNRFVTN
SQYAIDPNQVYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPGTTTAQ
IGYVPSGFTATTAANKCNAWAGSNAGKFSTQIAGAVWGTSDYTVAQAYGP
MDAAAMRLVYGGNFTQGSQVSISGGGTNTPYTDSNGKVRTHEISVSGMAH
AWPAGTGGDNTNYVDATHINYPVFVMDYWVKNNLRAG
aroae-q5p4k6: Aromatoleum aromaticum, Azoarcus sp. poly(3-hydroxybutyrate) depolymerase, 1 reference(s)Aromatoleum aromaticum EbN1 Show
MNARLNPNLLNPDLLEATRLTRAGQLLEATALIQRALGGRFAPPPAADAA
APDTPAADRAAEPPLEGSCRVIDIGPFVADPEPQPAQRDHADTTAKAGAP
AAEAVVSPLASRLGAALRDKLFKFRGAVPAFEPIVPGAAPETVPDGARFI
SGSYTNAAGTRCYKLYVPSNYGGEPVPLVVMLHGCTQNPDDFAAGTRMNE
LAEQEPCLVLYPAQSAGANGSKCWNWFKPSDQRAGQGEPSLIAGMTREIA
ASYNVDRQRIYIAGLSAGGAMATTMAATYPDLYAAAGIHSGLPHAAAHDL
PSALAAMQQGSARAAGIRATGAGTSREMPHPVPVIVFHGDRDTTVHPRNG
EQVIVQFAPAGVRTGSIGVGSKPRASIERGQVPNGRAYTRTTYHHPNGSP
HVEQWTVHGAGHAWSGGSSRGSYTDPQGPDAAKEMLRFFLAHPAGKAAPE
PGRSV
aspaw-AXE1: Aspergillus luchuensis; Aspergillus awamori AlAXEA Acetylxylan esterase A, 6 reference(s), 1 structure(s).e.g. 5X6SAspergillus luchuensis Show
SGSLQQVTDFGDNPTNVGMYIYVPNNLASNPGIVVAIHYCTGTGPGYYGD
SPYATLSEQYGFIVIYPSSPYSGGCWDVSSQATLTHNGGGNSNSIANMVT
WTISKYGADSSKVFVTGSSSGAMMTNVMAATYPELFAAATVYSGVSAGCF
YSNTNQVDGWNSTCAQGDVITTPEHWASIAEAMYSGYSGSRPRMQIYHGS
IDTTLYPQNYYETCKQWAGVFGYDYSAPEKTEANTPQTNYETTIWGDSLQ
GIFATGVGHTVPIHGDKDMEWFGFA
aspc5-a0a1r3rdf7: Aspergillus carbonarius (strain ITEM 5010). Carbohydrate esterase family 1 proteinAspergillus carbonarius Show
MMRLTLLLTYLFYTLISAHAITPRAGSLTQVTDFGDNPTDVGMYIYVPTN
LASNPGIVVAIHWCTGTGPSYYSATPYATLSETYGFIVIYPSSPYSGTCW
DVSSQATLTHNGGGNSNSIANMVTWTINQYGADSSKVFVTGSSSGGMMTN
VMAATYPELFAAATVYSGVSAGCFYSSTNQVDAWNSTCAEGEVITTPEHW
ASIAEAMYSGYAGSRPKMQIYHGSVDTTLYPQNYYETCKQWAGVFGYEYS
DPTETEPNTPETNYETTIWGENLQGIYATGVGHTVPIHGDRDMEWFGFA
aspcl-axe1: Aspergillus clavatus Probable acetylxylan esterase A, 1 reference(s)Aspergillus clavatus Show
MAPFSFLLTLLLYTLSAGASVLESRSSALLPRAGSLQQVTNFGDNPTNVG
MYIYVPNNLASNPGIIVAIHYCTGTAEAYYNGSPYAKLAEKHGFIVIYPE
SPYQGKCWDVSSRASLTHNGGGNSNSIANMVKWTIKKYKTNTSKVFVTGS
SSGAMMTNVMAATYPDMFAAGVVYSGVAAGCFMSNTNQQAAWNSTCAHGK
SIATPEAWAHVAKAMYPGYDGPRPRMQIYHGSADTTLYPQNYQETCKEWA
GVFGYDYNAPRSVENNKPQANYKTTTWGKELQGIYATGVGHTVPINGDRD
MAWFGFAK
aspfu-axe1: Aspergillus fumigatus (Sartorya fumigata) Probable acetylxylan esterase A, 1 reference(s)Aspergillus fumigatus Show
MRALSVFVALFSFLALSSASPGQDVAKRVTSGSLQQVTNFGSNPSGTLMY
IYVPNNLATKPGIVVAIHYCTGTAQAYYTGSPYAQLAEKYGFIVIYPQSP
YSGTCWDVSSQSALTHNGGGDSNSIANMVTWTISQYNADTSKVFVTGSSS
GAMMTNVMAATYPELFAAATVYSGVPAGCFYSSSNQVNGWNSSCAQGNVI
STPEVWGGIAKAMYPGYTGPRPRMQIYHGSVDTTLYPQNYYETCKQWAGV
FGYNYNSPQSTQSNTPQANYQTTIWGPNLQGIFATGVGHTVPIHGEQDME
WFGFTGGSSSTTTTATTPPTTSTTTSSGGSSTSTGVAEH
aspnc-axe1: Aspergillus niger; Aspergillus ficuum Porbable acetylxylan esterase A, 2 reference(s)Aspergillus niger Show
MLSTHLLFLATTLLTSLFHPIAAHVAKRSGSLQQITDFGDNPTGVGMYIY
VPNNLASNPGIVVAIHYCTGTGPGYYSNSFYATLSEQYGFIVIYPSSPYS
GGCWDVSSQATLTHNGGGNSNSIANMVTWTISEYGADSKKVFVTGSSSGA
MMTNVMAATYPELFAAGTVYSGVSAGCFYSDTNQVDGWNSTCAQGDVITT
PEHWASIAEAMYPGYSGSRPKMQIYHGSVDTTLYPQNYYETCKQWAGVFG
YDYSAPESTEANTPQTNYETTIWGDNLQGIFATGVGHTVPIHGDKDMEWF
GFA
aspng-a0a100iph2: Aspergillus niger; Aspergillus tubingensis. Acetylxylan esterase A, 3 reference(s)Aspergillus niger Show
MLLSTHLLFVITTLFTSLLHPIAAHAVKRSGSLQQVTDFGDNPTNVGMYI
YVPNNLASNPGIVVAIHYCTGTGPGYYSASPYATLSEQYGFIVIYPSSPY
SGGCWDVSSQATLTHNGGGNSNSIANMVTWTISEYGADSSKVFVTGSSSG
AMMTNVMAATYPELFAAATVYSGVSAGCFYSNTNQVDGWNSTCAQGDVIT
TPEHWASIAEAMYSGYSGSRPRMQIYHGSIDTTLYPQNYYETCKQWSGVF
GYDYSAPEKTEANTPQTNYETTIWGDSLQGIFATGVGHTVPIHGDKDMEW
FGFA
aspor-axe1: Aspergillus oryzae; Aspergillus flavus Acetylxylan esterase A, 3 reference(s)Aspergillus oryzae Show
MILLSYLLTYLLCALTCSARAIHNGRSLIPRAGSLEQVTDFGDNPSNVKM
YIYVPTNLASNPGIIVAIHYCTGTAQAYYQGSPYAQLAETHGFIVIYPES
PYEGTCWDVSSQATLTHNGGGNSNSIANMVTWTTKQYNADSSKVFVTGTS
SGAMMTNVMAATYPNLFAAGVAYAGVPAGCFLSTADQPDAWNSTCAQGQS
ITTPEHWASIAEAMYPDYSGSRPKMQIYHGNVDTTLYPQNYEETCKQWAG
VFGYNYDAPESTESNTPEANWSRTTWGPNLQGILAGGVGHNIQIHGDEDM
KWFGFTN
aspor-q2ur69: Aspergillus oryzae (Yellow koji mold) Feruloyl esteraseAspergillus oryzae Show
MKFLSVILLTTTAGLASAAGSAGCGQPLPPSQNPGGSSYGVNFTLSAGTQ
RFYRIHIPSNYNVNTPTPLIFSFHGRGKTAESQEKLSQFSNEDWNPDAIA
VYPQGLNKEWQGDPHSKDVDDIAFTMEMLDYFQEKFCIDSTRVYAAGKSN
GGGFTNLLACDPTASTRIAAFAPVSGAYYQDVSEEACHPTTVPIKCSPGR
PSIPILEFHGTADKTIPYGGGGRRGECLPSIPHFVREWSKRLGYGLHNTT
KELYDGNVQEYQYGNGDNRGIVTHYRIGGLGHDWPSVRPNSDNPNGTYLD
ATPIIVKFFKQWVLPGSSEDNQSEAR
asptn-axe1: Aspergillus terreus (strain NIH 2624 / FGSC A1156) Probable acetylxylan esterase AAspergillus terreus Show
MAPFSFILTVLLYALTCSARALGHAHALLPRAGSLEQVTDFGDNPTNVGM
YIYVPNNLASSPGIVVAIHYSPEGTGTAEAYYTGSPYAQLAEQYGFIVIY
PQSPYEGTCWDVSSQETLTHNGGGNSNSIANMVTWAISKYNADSSKVFVT
GSSSGAMMTHQNVMAATYPELFAAATVYSGVPAGCFYSSSNQQDGWNSTC
AQGQVITTPENWANVAKGMYPGYNGTRPKMQIYHGSVDTTLLPQNYYETC
KQWAGVFGYNYDSPQQVQDNTPQSNYATTTWGDDLQGIFATGVGHTVPIR
GDDDMAWFGFA
azovi-q4itf2: Azotobacter vinelandii AvOP esterase, phb depolymeraseAzotobacter vinelandii AvOP Show
MNARRNSDLLEATRLTRSGQLLEATALIQRALGAPRPAANASPKSRAGET
VIEGCFRVIDSGPFAADSTAQDIDRDVAGTQDGPEPVTEPFFPSSRFGAA
LREKLFKFRGPAPVFDPILPQQAPKAIPEGAQFITGSYTNPAGTRSYKLY
VPSGYDGQPLPLVVMLHGCTQSPDDFAAGTRMNEFAEKEPCLVLYPAQST
AANCSKCWNWFNPSDQCADQGEPSLIAGMTRDVAACYKVDPRRIYVAGLS
AGGAMATTMAMTYPDLYAAAGIHSGLPHAAAHDLPSAFAAMQQGAKCAGR
QTTSVGNNRAPARPVPIIVFHGDQDTTVHPGNGDQVIAQFSPTASHPAAQ
PKTGANPSAKVERGQVPNGHAYTRTVYRHPSGSPHVEQWTIHGAGHAWSG
GSTHGSYTDPRGPDATKEMLRFFLAHPFQ
braja-BLL1128: Bradyrhizobium japonicum bll1128 protein, 1 reference(s)Bradyrhizobium japonicum Show
MRRWMHIGALLAGFATAPAASADTIDVNGVMRSYTVQLPAKRLVPLVVVL
HGKTQRGADMVARTAWPQVAKREGFAVVFPDGLNHAWADARTKAGPALRG
PPEGTDDVAFIAKLVEKLVTNGTADPGRVYVAGISNGGAMAMTLACARAD
LFTAGASVIMNLTDEAAVTCHPSRPLPMLIMNGTADPLVPYEGGRGSSYF
AADGFWSTEETFAFWRKLNGCETDDANLTEMPDRAPADQSTVTRISSRCP
RGHDVVLYRVNHGGHRMPGFAPDARFPKVATSLLGPQNSDIDGAETIWTF
FSQFP
braja-BLL4997: Bradyrhizobium japonicum (strain USDA 110) bll4997 protein, 1 reference(s)Bradyrhizobium japonicum Show
MLNQDIVREATRLTRAGQLVKATALLQRMLQGGRALRPESRSASQARLPR
LDPLTIDATADVVEERKAPQIAPARSAQGRRHSLPLDGMRDFSGLGLRSP
IKRAPLSPSDIVPEGTRFIAGTFSNAAGSRTYKLFIPSRCQGQRLPLIVM
LHGCTQSPDDFAAGTRMNFLAEEQNCFVVYPEQPSGANQAKCWNWFRTGD
QRRGGGEPSMIAGITRQIMRDHVIDPKRVYVAGLSAGGAAAAIMGATYSD
LYAAVGIHSGLACGAASDLPSAFVAMRQGGGSRAIADGITSVPTIVFHGD
RDTTVHPKNGDQIIEQSAGATRPTTKVLRGRVPHGHAYTRTVLIDGAGRA
ISEHWNIDGAGHAWSGGSPAGSYTDPQGPDATREMLRFFLEHSLGG
braja-BLR0899: Bradyrhizobium japonicum (strain USDA 110) poly(3-hydroxyalkanoate) depolymerase (EC 3.1.1.-), 1 reference(s)Bradyrhizobium japonicum Show
MDVERRLPGVAVSLARNIDLLRRLPKVDGLRFADFGRSADAPGPLQEVAD
FGDNPGNLRMFAFAPAQLQMPRALVVVLHGCGQTAAAYDLGAGWSTLARH
YGFALLMPEQQRVNNGNTCFNWFNPEDTARDSGEARSIREMIAHMVKTHR
IDPRRVFITGLSAGGGMTSVMLATYPEVFAAGAVIAGLPYGIASNLREAL
DGMFHSPARPARELGDLVRNASDYRGPWPKMSVWHGSADRTVNPGNANEI
VKQWLDLHDLPDVPMAETNVDGYPRQAWWNKDGETLVESYAITDMAHGTP
LGLADNDQRYGVEGAFLIEAGISSSYHIAKFFGLTGWIPDAAKKKAEAKP
GAPKPALTPAPHLARSIRDAVAEPPAEPKREDARGFDLGQIITRALTAAG
LMK
burpi-PDSPS: Burkholderia pickettii (Ralstonia pickettii) (Pseudomonas pickettii) poly(3-hydroxybutyrate) depolymeraseBurkholderia pickettii Show
MKHPYGYRWHWLYALVVTLMTALATFSAHAAVTAGPGAWSSQQTWAADTV
NGGNLTGYFYWPASQPTTPNGKRALVLVLHGCLQTASGDVIDNANGAGFN
WKTIAEQYGAVVLAPNATGNVYSNHCWDYANTSPSRTSGHVGVLLDLVNR
FVTNSQYAIDPNQVYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPAI
TRWKIGVVPSGYTATTAANNCKAWAGSNASSFNTQIAGAVWGTSDYTVAQ
AYGPMDTAAFRQIYGGTFTQGAQVSISGGGTNTPYTDSNGKLRTHEISVS
GMAHAWPAGTGGDNNNYVDATHINYPAFVMDYWVKNNLRAG
burvi-q4bgi5: Burkholderia vietnamiensis G4 esterase, phb depolymeraseBurkholderia vietnamiensis G4 Show
MRARSMTKSLTKVWLGGMKRMLSPAAQRAARDAQRIARETLEAAAAPIAA
ELSPVRESRVRPRAAAWATGEWTRGEHPMAPALGRLVQQLAYALYVPQGR
RRGPMPLVVMLHGCQQSADEFAQGTRMNLLADQHGFAVLYPEQSMRAHAH
GCWHWYEDTDRAGRGEADAVASLVDAVVDEHGFDASRVYVAGLSAGAGLA
TLLALHHPERFAAVALHSGPAVGEANSGISAMDVMRRGLRQNPAAAVDAL
VDAGAYPGMPALILQGDGDHVVAPKNADQLAVQFMRLNGLADSRGALRGG
ERVETRSAGAQITEVRREGVPVVRLCHVKGLDHAWAGGDEAVPFHAAVGP
DASAMIWSFFESNRRTVATERRVV
caucr-CC0847: Caulobacter crescentus hypothetical protein cc0847, 1 reference(s)Caulobacter crescentus Show
MAWADSAAQPGFRPFDRSLSFPRRYGGRRRSMTVGALTRRVAALMASLAF
LATAASVQAACAVGAPGATVSVDAGGTGRPFLLRRPAITDAPAPLLILLH
GSGGDGGKMLAASGLEATAERHGFLVAAPTAAIPAGKGFAWNIPGVPTVT
GKIPDASDADDVAYLAALVDGLVAQGCVEPARVYVTGLSGGGRMASWLGC
VASDRYGAIAPVVGLRAGNPRPDQPDEPDPASCRPDRPMPVIAFAGDKDT
TNPTQGGGAGYWQYTMHAAEQRWAALNGCQAPPTTQWVAPNVYEERYSGC
RDNADVVGRMTVGGGHTWLADNDALWAFVSRYRRDGR
chatd-g0s216: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) Carboxylic ester hydrolase AXE1B_CHATH CtFxeA, 1 reference(s)Chaetomium thermophilum var. thermophilum DSM 1495 Show
MLLPSLFGLATMASSCLAASLQQVWNFGSNPTNINMHIYVPDRLANKPPI
IVALHPCGGNAQQWFSGTRLPQYADRHGFILIYPSTPHMSNCWDVQNPAS
LTHGAGGDALGIVSMVNYAIDRYGADRDRVYVMGFSSGGMMTNVLAGSYP
DVFEAGAAYSGVPHACFLGAPAATPFSPNQTCAQGLQKTPEEWGNLVRNS
YPGYNGRRPRMQITHGLNDWLVRPQCAYESLKQWSNVLGLQLTRQVTSGQ
WTQHIYGDGTKLVGYLGQGIGHEPAVNEEQLLRFFGIIN
chatd-g0sbz2: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) Carboxylic ester hydrolase AXE1A_CHATH CtAxeA, 2 reference(s)Chaetomium thermophilum var. thermophilum DSM 1495 Show
MKLNNLASSLLSLVAVADAASLTQVTNFGSNPSGARMYIYVPDRLQTNPP
ILTAIHYCTGTANAFYTGTPYARLADQYGFIVIYPESPYSGSCWDVSSRA
TLTRDGGGSSTSIAQMVRWAIERYNADRNRIFVAGTSSGAMMTNVLAATY
PDLFKAAAAYAGVPAGCFYTGTVAGWNSTCANGQSIASQQVWAQTALDMY
PGYTGPRPKMMIYHGSADTTIYPQNFNETMKQWCGVFGYTYGSPQQTLAN
copc7-axe1: Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) (Inky cap fungus) (Hormographiella aspergillata). Acetylxylan esterase, 2 reference(s)Coprinopsis cinerea Show
EIPAGQLTQLRSFGNNPSNISMFVYKPQNVKNRPGLLVALHPCGGTAQQY
FSGFPGFRQHADQRGFIVLYGQSPPGSSNCWDIISTASLTREGGDDSTGI
ASAVKYALQNWNVDPEKVFVTGTSSGAMMTNIMAATYPDLFKAGAVWAGT
AVGCLSANTPQFPPDPCQSGTVIRTPQEWGDRVRRAYPGYNGPWPRMQIW
HGTNDFALDHKNLAEQMKQWTNVHNISQTPTSTSPSTPRQGWTKQVYGNG
LVETFSGQGAGHGLPESGTEVVAMDFFGL
cora7-c3pgf2: Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1 (Corynebacterium nigricans) Putative secreted protein, 1 reference(s)Corynebacterium aurimucosum Show
MGEDSAARLRWLRALAGAVAVAASVMALASCSSPEEEAPTATSSTEWTND
LGIPLAPMLVGPEPGHTKKVRLASGRSFLLHVPENYTPERSWPVLLSFHG
YTDSPENMEQYTQFNAAHAIVAYPAGEKAAWAPAPYAATSAEEDLEFVRT
LVDSLRSTYEVDDNAIYAAGLSNGGGFAAFLACRMPGTFRSVATVSAAYY
EGIHTDCSDRPVGRLDIHGTKDPVVNYEGGVRHDTAYSSVAEVLGQDQRR
NKCRGDVDSVRLTNGATRETWTACEAPLQHIRIEGGSHVWPGGNNDTKIE
VGQGFATDAVLDFFGIPGRPEGTEEHGVA
coref-CE0103: Corynebacterium efficiens hypothetical protein, 1 reference(s)Corynebacterium efficiens Show
MHKCPASLSWRGMEHPFRTLTLALAAGMTSAALAVAPAASAVAQAQPTAS
AAQSAPTTQVIGTNLLHASFTQDGMHREYLVKLPDNRDPARTYPIVLAFG
GKGDSATSFRSYAGLEQATAGGAIIVYAQGVDNAWAGAPYAATTMAQDVA
YVRTAVDDVVAHHGGDRGRVYAVGMSNGGGMATALGCHAPELVDATASVA
GAYYDPTVTGCNPRGGVPTLVIHGTNDGLMNYWGGTRHGAHYRGAYAVFE
SFAARNHCTVPVVHQVHEHPNSTTFRPAFCATPTEFVRIDDGGHEWSYTP
SVADISWGFLQRQ
coref-CE0104: Corynebacterium efficiens conserved hypothetical protein, 1 reference(s)Corynebacterium efficiens Show
MTPRFRPLSLPVVLTTLATLVATAAYALFPTSAVAQSSAPTLGTSQQLSS
QLAGGSASYNLIHRSITLAGLNREYHVALPAFFTPSRSYPVIIGFGGWDH
DALQFRDYAGLEQAARGEAIIIYAQGINDAWAGAPYASTTMSQDIDYVRA
AINDVISNYSGDADRIYATGLSNGGGMAAALGCHAPGLVDAIASIAGAHY
TPTVTGCQPGQVPTLLMHGTHDDAIAYGGGTRHGATYQGAHATFDSVAWR
NGCTASTRQTSDYHGTTTFRPHYCTTATELVRVNGGGHTWFTDPRAADVV
WDFFVRQG
corst-c2cmd4: Corynebacterium striatum ATCC 6940 Possible exported esterase/hydrolaseCorynebacterium striatum ATCC 6940 Show
MHVPEKYDPEKRWPLVMVFHGWGEEPKAIEGYTEMNAAQAIVVYPAGVEK
AWTPAPYAKTTEEEDLKFVADMVDSLRATYAIDDNRIFAAGLSNGGGFAA
FLACRMPETFHSIATVSAAYYEGIHKNCSGDPVGRLDMHGTDDPVVEYYG
GTRHGTKYDSVSTVMETNRKRNQCTTDVTTMRLVNNALQQTWVGCKAPLQ
HIRIGGGSHIWPGGRVDDRAEVGKGFATDRVLDFFGVPGRPAGTEDPESG
KKTS
cuppj-q46qx3: Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) (Alcaligenes eutrophus) (Ralstonia eutropha) esterase, phb depolymeraseRalstonia eutropha Show
MGRRGGSTARLWTALGKSATRQARRMGREMTRAINKSVTKPMTEAIVRNA
VKQSSAVTKATQRALSGVASPVPPPQSRGSGRWEEGVGGLGPLAQRNYRI
FIPAGVTARRRAPMLVLLHGCGQDAASFATVTRAVTVAREAGCVVLLPEQ
SSQGNAQRCWNWFRPATRGSAEAALLMAMIDHVCGRYPVRPDRVSVMGLS
AGGAMAMMLGLRYPDRFIGVSSHAGAVPYSAGNTAQAGAAMRGSRVPDAA
ARQALRLWLAGRPLPPLLLLHGDRDSVVSVENAMTAARLWLDLLPDPSVR
LVVPGARRVQRGQRLPAEVSDWLVDGEIFVRLVRIEGLGHAWSGGPAAQA
FSDPRGPDALRIALRFFGDR
cuppj-q46v50: Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) (Alcaligenes eutrophus) (Ralstonia eutropha) esterase, phb depolymeraseRalstonia eutropha Show
MAKSLATDWQAQFRRMSRAQAQTEAQVKSWLERIESLSPLAPRRRIRTPH
GVPLSPRYPVPQLPGSWESHRLRLAPQPGELVPQLSYHLYVPASAKHRFR
GPLPVVVMLHGCRQTPDDLAAGTRMNALAEREGFIVAYPQQPLRRQLQRC
WQWFDLAAGEGGREAQAVAALIDALARRHDVREDQVYLAGMSAGAAMAAV
VALRYPERVAAVGLHSGVVVGAADNPGAGLRAMLHGSEADPAWLVDAVGA
TPGGPELPAIVVHGLDDDAVHPVNGRLLARQFLAYNRLEDRLRGIEEADI
DLPAGHFHEARFGRWSRDLVTLVEVEGLGHAWSGGDGDYSYHSATGPDAS
AMMWEFFREHSR
decar-q47ec8: Dechloromonas aromatica (strain RCB) phospholipase/carboxylesteraseDechloromonas aromatica Show
MARRIRKTVWSRSFQSALKAMTRTAMRVGTKAIKQSLRAAPLTSQRKPVK
KATAHSANWTKGIAIGAAGPRGYRLYKPSGMRRNETRPLLVMLHGCGQDA
EALAASSRMNTIAARERFFVLYPEQDRLSNVQGCWNWYDTRTGRAQAEAN
SISAAIEQICLSQAVDRSKVALAGISAGAGMAVLLATHHPERFRAIAMHS
GIAPGVAHSSASAIKAMFGQSVTSSPLPAIPPDVRLPALLVIHGAADHVV
APGNGAEAAMRWGERVGAKTSKPRLVQRGARYAATITDYRKSGRLVATLC
AVDRLGHAWSGGAAGHSYSDPKGPDASRMIWSFVARQFARSAD
emeni-axe1: Emericella nidulans (Aspergillus nidulans) AN6093-2 Acetylxylan esterase A, 4 reference(s)Emericella nidulans Show
MVKLQYLLSILLYAYSCTALMLDRRDPTPGQLSQVTDFGDNPTNVGFYIY
VPQNLASNPAIIVAIHYCTGTAQAYYSGTPYAQYAETYGFIVIYPESPYS
GTCWDVSSQSTLTHNGGGNSNSIANMVDWTINQYNADASRVYVTGTSSGA
MMTNVMAATYPNLFAAGIAYAGVPAGCFYSEANVEDQWNSTCAQGQSIST
PEHWAQIAQAMYSGYEGSRPKMQIYHGSADATLYPQNYYETCKQWAGVFG
YNYDSPQEVQNDTPVAGWAKTIWGENLQGILADGVGHNIQIQGEEDLKWF
GFTS
herss-d8iwn7: Herbaspirillum seropedicae Plasmid partitioning proteinHerbaspirillum seropedicae Show
MTIRLLSRLRPFPPLRSLPRLSRRGLMACLLGLGLGVAAPPSAQAVDLSL
KTIRVGNLSRAYFSERTSVGEARPLIIALHASGSSGSLMARATGLTEIAE
AAGYMIAYPNGTGLAIDARTWNSGGCCGYAQMHKVDDVAFLRALVEKLAK
DGLADPQRVYLVGVSNGGMMAYRMAAEAPGLFKAVAVVSAVLDVPPETVK
APMPVLHIHGSEDPFIPFLGGIGKQEVSQLPRLSVARTIETWVKANGAEP
RPAVTDIADTANDGTTIRQYTYRSKTDPQSVVLYEVKGGGHAWPGAVIPI
INGGKSSQNMDASRTVVEFFNAHGGGRSDEAVDENLPPGAKPLPAATPAP
AAAPTPTPTPIPAPTRPAR
lepbp-b0slj1: Leptospira biflexa serovar Patoc (strains Patoc1/ATCC23582/Paris; Patoc1/Ames) Putative lipoprotein, 1 reference(s)Leptospira biflexa serovar Patoc Show
MRRYWEPNMTKRIHRFNSILLCICLIAFCGCERGCIRSAIKDRFQKKMRD
LPAPITNSDLSQSITTPGDYLFSILHQEIPRYYKVHVPKTYTGKESVPLL
FVFHGGGGDMEIQSNEEYYHQISKSEEIGNIVVFPNGYSEYKSGKIATWN
AGNCCGEAKKQNIDDLGFVKSILKHLKQKLNVDEKRIFSTGMSNGAMMSY
QLACFMTEDFAAITAVAGTDNTIDCKPQKPISIFHIHAKNDDRVLFYGGA
GSSFTDRTLVTDFVSVNKSISKWVQFNGCQTVPKIVLKNQGAQCEEYSGC
KDGVKVKLCVTEDGGHSWPGGKKPSILLGGGPPSKAISANEEMWDFFKSL
marsp-PHAZ: Marinobacter sp. NK-1 poly(3-hydroxybutyrate) depolymerase, 1 reference(s)Marinobacter sp. NK-1 Show
MQHLLSGWIRRIALPVLTLSTLIILPSLPAHAGQTDSYTLPQQAYNQSRA
RDYKVYVPDGLTSPAPMVMALHGCKQTNNDVLNDWGLKAAADRYGFILVA
PYITSYDGLRNQNCWGFWFDHHRHEGAGEVEDLHQIALAVEGNYSIDPQR
RFITGLSSGGAMTAVAAITHNEYWAAAASASGLPYGEDSSSVSLTGQCPG
NATFHSVSRVVSDMQAELNDPYPIPMMVLQNKNDCTVLKKAADNIRDAHL
KVFGEAGFDTPSGADAGTVNCSPYYQNDYNCTHTRYTQDGTTGTRSVVET
VYLDGPLSTPNTQDTDHGHYWVSGKDGNNGKWAIRVGPSYPDIIWNFFAA
HDRD
mycle-LPQC: Mycobacterium leprae putative secreted hydrolaseLPQC, 2 reference(s)Mycobacterium leprae Show
MNVARWLASVVLAVCLAGCVGRQVSASSRDQPGTFQFGGLNRTYVLHVPP
GSPVGLVLNLHGGGGTGAGQQGLTDFDAVADLNNLLVAYPDGYDKSWADG
RGASPADRRHVDDVGFLVELAAKLQSDFGVAPGHVFVTGMSNGGFMSNKL
ACDRADMFAAIAPVAGTLGVDVACHPSQPVSVMDAHGTDDPLVPFNGGDV
HGRGGVSHVVSVTNMVEKWRTADGCQGDPSQQELPDVGDGTFVRRFDYTV
CANSAEVVFYKINKGGHTWPGGKQYLPKVVIGSTTCVFDASEVIAQFFLT
HARS
mycse-axe1b: Myceliophthora sepedonium, Corynascus sepedonium Carboxylic ester hydrolase AXE1B_MYCSE MsAxe1, 1 reference(s)Corynascus sepedonium Show
MKIPSSLSFLGLVPTLIAAASLTEVTEDFGPNPRNVNFYIYVPDDLPANA
PILVNPHWCHGTAQAAFQGSQWATLASQHKFIVIYPGTPATSTDQCWDVS
SRETLTHEGGGDSLGIVSMVRWAVDKYQADDSRVFATGVSSGGMMTQVLV
GSYPDVFAAGAAFAGVPFGCFAPPGNNTGQFGYWNSDCATGNVTHSAEEW
GNTVRAAYPGYDGWRPKLQIFHGTVDETVSYVNHVEAIKEWTNVLGLSET
PEEVVENTPLPGWTKSVYGPTGWFEAYSAAGVPHNIQVQENTALAFFQLN
CTADCFSWGQGGPSSEQARI
mycse-fae1c: Myceliophthora sepedonium, Corynascus sepedonium Carboxylic ester hydrolase FAE1C_MYCSE MsFae1, 1 reference(s)Corynascus sepedonium Show
MFVRTFLGLAATAATCLGASLQEVTNFGDNPSNIQMYIYVPDQLAANPPV
IVALHPCGGNAQQWFGGTQLPSYADSHGFILIYPSTSHMSNCWDIQNPDT
LTHGQGGDALGVVNMVNYALETYSGDSSRVYAMGFSSGGMMTNQLAGSYP
DVFEAGAAYSGVAFGCSAGAESATPGSANQTCAQGLQHTEQEWGDFVRNA
YPGYTGRRPRMQIFHGLADTLVRPQCAEEALKQWSNVLGVEFTQEVSGVP
SAGWTQKIYGDGTQLQGFFGQGIGHQSTVNEQQLLEWFGLL
myctt-faeb: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile) MtFae1a Feruloyl esterase B, 3 reference(s)Myceliophthora thermophila Show
MLVRSFLGFAVLAATCLAASLQEVTEFGDNPTNIQMYIYVPDQLDTNPPV
IVALHPCGGSAQQWFSGTQLPSYADDNGFILIYPSTPHMSNCWDIQNPDT
LTHGQGGDALGIVSMVNYTLDKHSGDSSRVYAMGFSSGGMMTNQLAGSYP
DVFEAGAVYSGVAFGCAAGAESATPFSPNQTCAQGLQKTAQEWGDFVRNA
YAGYTGRRPRMQIFHGLEDTLVRPQCAEEALKQWSNVLGVELTQEVSGVP
SPGWTQKIYGDGTQLQGFFGQGIGHQSTVNEQQLLQWFGLI
myctt-g2qd29: Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile); Thermothelomyces thermophilus Carboxylic ester hydrolase FXE1A_MYCTH MtAxe3, 1 reference(s)Thermothelomyces thermophilus ATCC 42464 Show
MKLLSQLSAALALAGGRLAVAHPVFDELMRPTAPLVRPRAALQQVTNFGS
NPSNTKMFIYVPDKLAPNPPIIVA