Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Homoserine_transacetylase_like_est

Homoserine_transacetylase_like_est


Genes:Proteins in Homoserine_transacetylase_like_est (14)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9psed-q0mrg5: Pseudomonas veronii Homoserine O-acetyltransferase like esterase MekB, 3 reference(s), 2 structure(s).e.g. 5EFZ, 5E4YPseudomonas veronii Show
MNSYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAI
LVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGG
SLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAV
RYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAV
AAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMD
PNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDD
CLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPAY
corgl-CGL0839: Corynebacterium glutamicum (Brevibacterium flavum)CgHle CGL0839 homoserine acetyltransferase like esterase, 3 reference(s), 2 structure(s).e.g. 5D6O, 5D7BCorynebacterium glutamicum Show
MLDNSFYTAEVQGPYETASIGRLELEEGGVIEDCWLAYATAGTLNEDKSN
AILIPTWYSGTHQTWFQQYIGTDHALDPSKYFIISINQIGNGLSVSPANT
ADDSISMSKFPNVRIGDDVVAQDRLLRQEFGITELFAVVGGSMGAQQTYE
WIVRFPDQVHRAAPIAGTAKNTPHDFIFTQTLNETVEADPGFNGGEYSSH
EEVADGLRRQSHLWAAMGFSTEFWKQEAWRRLGLESKESVLADFLDPLFM
SMDPNTLLNNAWKWQHGDVSRHTGGDLAAALGRVKAKTFVMPISEDMFFP
VRDCAAEQALIPGSELRVIEDIAGHLGLFNVSENYIPQIDKNLKELFES
mycs2-i7gg46: Mycobacterium smegmatis Homoserine O-acetyltransferase MSMEG_6772Mycobacterium smegmatis Show
MRQGLSRRHLQATTQRWRAMDEFPQDYELFDLGDVTLQHGATLRDAKLAY
KTYGELNADKSNAIVYPTWYSGRHWDNEWLIGEGKALDPAKYFIIVPNML
GNGLSTSPSNTPPPYNAARFPHVTFYDQVEVQHQLVTSFGIETLALVTGW
SMGAGQTYQWAVSYPDMVQRALPFCGSSKTSEHNIVFLEGVKSALTADAA
FKEGWYTEKPTKGIRAAARVYAGWGFSQAFYWHQEYKKMGYSSLEDFLVG
FWEGFFLDRRDPNNLLAMLWTWQNGNVGNTPGRGFHGDQVAALKTIKAKM
IVAPAEKDLYFPPEDEEFAVKHIPDAELRVIPGIYGHFAGGDANPEDNKF
IDGLVRELLAR
9baci-q2bd09: Bacillus sp. NRRL B-14911 homoserine o-acetyltransferase likeBacillus sp. NRRL B-14911 Show
MDYEIYNLGDVTLQSGVTLPNAFLAYKTYGELNEKKDNVIVYPTAFGDQH
VQNEWLIGEGMALDPRKYFIIVPNLLGNGLSSSPSNTPAPFDRSSFPQVT
IYDNVTLQHRLVTEKFGIQKIALVLGWSMGGLQSYQWGASYPDMVERIAP
FCGSAKTWPHTFMVLDGMKASLMAAVGFDSSKLNELTSAEMRAAGHVYGG
WGLSQAYYREALYREMGFDSLEDFIAGVWEDSFMKMDPHNVLAMLWTGQY
ADISANPAYNGDFDLALRSIKALACVMPGSTDLFCTAADNKYEASLLPNA
VYKPIESMWGHFAGRGINSRDNKFIDDNLKSLLSLGKE
brasb-a5et73: Bradyrhizobium sp. BTAi1 homoserine o-acetyltransferase likeBradyrhizobium sp. BTAi1 Show
MTSVADYQIFEAGDVVLQSGATVPSLRLAYKTYGTLNAAKDNVILYPTSF
SAQHVDTEWLVGPADILDSDRYFIIIPNLFGNGLSSSPSNTPPADAPFPA
ISYHDAVAIQRRLVEEQFGITRIALVYGWSMGGMQAYHWAACHPDMVERA
AVVCGSARCSPYNHVFLDAVKAALIADPAYKNGRFVAKPVAGLRAMGRIY
AGWAMSYEFYRDEVWREQGFAAQEDYLAATWDTAFAHRDANNLLAQIAIW
QNGDISHCSAFGGDLDRALSAITAHMLLMPGQTDRYFDWRDNERELPKLV
NASSAVLRPIPSIHGHRAGNPIRIPADRDFIKANILTLLQS
9burk-q4av60: Polaromonas sp. JS666 alpha/beta hydrolase foldPolaromonas sp. JS666 Show
MEQQARHLIDTFALQCGTTVRALRLEYAMHGQLNHERTNAILFPTWFGAT
HKANSWIIGPGRALDTEKYCVIVVNALGNGRSSSPSNHPDLLHGGRPVPV
SLHDNVVAQADLVRALGIEKLFAVIGRSMGAQQAFQWGCLYPDRTGRIFA
FCGTPATSTHNRVLLEGMATILEAAANSEDSAKDALRNAGRVYAAWVLSH
EFFNDGSWKGERPMDWVSRMILPAFLEFHRHDILSLIRTWQFADISANAR
FGGNLKNALEAITVPVFLMPISHDLIFPPQDFEECARHLPNSRTTVLYSI
WGHRAGAPNSDAADIAELETAIRGFLLHPAGDACLAPGR
9noca-q6rej1: Rhodococcus sp. DK17 putative homoserine acetyltransferase likeRhodococcus sp. DK17 Show
MIENPYYTNEFHGDYELIGIGQLDLEEGGSIPDCQLAVATFGVLNEAKDN
AILIPTWYSGTHQIWRDVYIGPDHALNPEKYFIVCIDQIGSGLSVSPHNA
AGANAGIAMSKFPHVRIGDNVVAQERLLREHFGIERLALVTGGSMGAQQT
YEWAVRFPDKVLRAAPIAGTAQNTPGDFLIAEAMREAIQSSPGWNGGEYT
SNEQVVDGLIRQAHIWAIVGFSTEFWKHEVWRAMEFDSKEAFLSGFLEPY
FTAMDPNALLTQSWAWQRGDVARHTGGDLAAALGRITAKTFVMPIDEDQL
FPVRDCVPEQELIKNSELRVVEDTLGHLGLFGVSPTYMPQIDRHLGDLLD
IEV
aspcl-a1cns2: Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCT3887 / NRRL 1) Homoserine acetyltransferase like, 1 reference(s)Aspergillus clavatus Show
MAGKEYEIFKLGDWELQSGEKLPDAHLAYTTFGDPSSPAIVYPTWYTGLI
SDNLWLIGDDKVLSPKKYFIIIPALFGNGQSTSPSNQKHSGPFPTCSFYD
NVRAQYKLVTEHFGIKHLRAVIGWSMGGAQTFQWATQFPDFMDLAVPFCG
AARTSVHNQVFLEGVKSALLAPKYIPSAGSGKLGLMKAGETVRTWTAEEK
EIGLKAFARVYAGWGFSQAFYREKLYESVLGFKNLEDFMQNFWEKWGLSK
DPENLLAMLQTWQSWDVSKQAPYNGDFEKALASIKAKTLVMPGKTDLYFP
PEDSEYEVACMKPGVGELRVFPSIWGHWAGGPGQSKDDVKWLDEQLAEFF
KN
braja-BLL7862: Bradyrhizobium japonicum bll7862 protein, 1 reference(s)Bradyrhizobium japonicum Show
MHRHFSGAFCDRVSGVERMTAQRDYETFEAGDVTLQSGAIFPSMTLAYKT
YGTLSPAKDNVILYPTSFSAQHYDTEWLIGSGGVLDPERYFIIIPNLFGN
GLSSSPSNTAGPFPEPTYHDAIAVQHRLLTGRFGISKLALVYGWSMGGMQ
AYHWAASHPDMVERAAVVCGSARCAPYNHVFLESVKAALTGDPAFRNGRF
VEKPTVGYRAMGRVYAGWAMSHGFYRDELWREAGFSSLEDYLVRGWDATF
ARRDANDLLAQIGIWQSGDISRCAAFGGDLDRALAAIKAHMLLMPGATDR
YFDVRDNEDELGRLVNAKSAVLHPIPSLHGHRAGNPVNNPPDQAFIRAEI
AQLLSK
glovi-GLL2500: Gloeobacter violaceus proable homoserine o-acetyltransferase like, 1 reference(s)Gloeobacter violaceus Show
MTRSAEAFALENFALQCGTVLTRAQLVYQTHGELARGRDNAVLYPTSYGA
RHADIDWLIHPDRILDPRRYFVIVVNMFGNGLSTSPSNCEKCALAEQRFW
FTHFDNVRAQERLLIEVFGIERLAMVYGWSMGAQQAYHWGALYPERVERI
AALCGTARTTDHNRVFLESLRAALTADPAWTGSGFDGIPERGYRAFARIY
ASWAASQAFYREGLYYKLGYDSLEDYLQRGWEANYRKRNPHDLIAMIDTW
LRCDVGDNPIYRGDYCGALAAIRARTLVMPGATDLYFTPEDCAVEAARIP
DAEYRPIPSIWGHRAGNPYQNPEDAAFIRAAVRELLDRPAL
solus-q43s18: Solibacter usitatus Ellin6076 homoserine o-acetyltransferase likeSolibacter usitatus Ellin6076 Show
MKALVLLILCRAAIAQSPVTPERHEFIISDFHTESGATLPQARIVYGTYG
HLNADHSNAVLLPSHYMANLRGYEWLIGSGKALDPAQLFLITSELFGNGS
SSSPSNTPEPFHGPRFPVMTIRDNVEAVHRLLTEDLKVTHLRAVIGFSMG
AQQAFQWAVSYPDFADRIVATSGTAKTYPHGIVRLEGQIAALTADAAFLN
GDYTSPPKKGLEAFGMVWAAWLYSQEWWRRELWRASSPAGTTFEQVSNRF
RTRFNADANDYILQARTWQHHDVGATPGFSGDTERALRSIKVPLLYMPSE
TDLYFPVGDARFEAPFIPKVTLMPIPSLWGHTAGAASNPADAKFLNENIA
KFLLIGRQ
strcl-CVM4: Streptomyces clavuligerus putative deacetylcephalosporin c acetyltransferase like, 1 reference(s)Streptomyces clavuligerus Show
MECRIFEIDELPLLDGEVLRDARIGYAMYGTPNADGTNVVLCPSFFGRDH
TGYDWLIGAGLPLDTRRYCVVTAGLFGNGVSSSPGNHPSGSRFPLITPQD
NVAAQHRLLTEELGVRELALVTGWSMGAAHAYQWAVSHPGMVRRIAPICG
APVSSPHSLVLLSGLAAALSADAGERGRKAAGRVFAGWGTSRSFWARRAH
RELGFATREEYLTGFWEQVFLSGPGAADLLTMVRTWENTDVGATPGAGGS
VEAALASVTARAVVLPGALDVCFAVEDEKRVADLLPYASLEVIPGVWGHL
AGSGGSAADREFIGGALRRLLDSPVDGG
synjb-q2jhu6: Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime) putative homoserine o-acetyltransferaseSynechococcus sp. Show
MTHYTWSLNDFQLQCGIQLPQITLAYATYGTLSPRKDNLILYPTSYGAQH
PDLEWLIRPDGILNPQRWFILIPNMLGNGLSTSPSNDPACGLREDGFWFS
HWDNVRLQESLIRQHFGIERIRLIYGWSMGAQQAYHWGSLFPERVERIVA
LCGTAKTTVHNRVFLESLRSALTADPAWNGRRFTGVPERGLRAFAHIYAS
WAVSQPFFNQKCYESLGYASLEDYLERGWEANYRRRDPQNLLSMIETWIR
CDISDNPIHRGDYRAALRAIQAQTLVMPAQTDLYFTPEDCRAEAEWIPNA
VYKIIPSIWGHRAGNPHQNPEDEAFIRTAVQEFLES
synp6-q5mzf3: Synechococcus sp. (strain PCC 6301) (Anacystis nidulans) (strain PCC 7942) (Anacystis nidulans R2) homoserine o-acetyltransferase likeSynechococcus sp. Show
MTVGTFRLPNFELDCGAVLPEASLVYATYGELNRDRSNAILYPTSYGAQH
STIDWLIGGDRILDPDRWFIVIVNQFGNGLSSSPSNDPACGLAEQGFWFS
HWDSVCAQQALLSQVLGIEQLALIHGWSMGAQQAYHWAIAFPDRVQRIAA
LCGTAKTTEHNRLFLESLRAALIADPTWDGQRFQATPDRGYKAFARIYAS
WAASQAFYRAGIYRQQGYSSLEDYLERGWEANYRQRDPHDLLAMIDTWLR
CDVSDRPAFGGDLAKALGSITAQTLVMPSTTDLYFTPEDCEAEAQLIPKA
HYCPIPSIWGHRAGNPSQNPQDESFIRQAVQALLNAEA
Sequences



Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer