Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Insect_lipase

Insect_lipase


Genes:Proteins in Insect_lipase (83)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
helam-a0a2w1b5z2: Helicoverpa armigera (Cotton bollworm) (Heliothis armigera) Lipase domain-containing protein, 1 reference(s)Helicoverpa armigera Show
MEGLVFLLFGLAVVSALPHDPIIRKLDSGLRFQYMRGPDGTPHLVDLWGT
VEDLAKAARYNPDRQNVYHLFTRQNPTVSQPLLIGSEGLLGITNYSPNRR
TVVLVHGWLDSVTSDFNSVLVPAFLSAEDVNVIVVDWSAGAGTINYFTAL
ANTVPSGESVARFITWLNQATGAVPAMYHLVGHSLGGHQVGIIGRNVGGQ
IAYITGLDPAFPGWNTNNDKFRPTDGVYTEVIHTNVGLLGYMATLADADF
YPNGGLNMPGCSTQECDHLRSFYYMGESLRTGGFTGQRCLSYLTAMTGNC
HLWGTLRMGGLVPKTGQSGIYYLETNASPPFSRG
antpe-a0a191xqw7: Antheraea pernyi (Chinese oak silk moth) Lipase-related protein, 1 reference(s)Antheraea pernyi Show
MATLSAIALTSIVIISAVNAAMYAPKPIVGYPAGLIPDCPGSTKNATISA
KMLPELQLTIHKVESNGMITRRSVPVESAPRVVSKDKRIDVINKRTVLYA
VGFLDSSVFPHSQAIGTAYAKRGYNVFLTETIIFFTQIYPKSVRLTRIIG
KKMGDFLVKLTEQGLSADNLELVGASLGAYVVAYAAKHFYERTGKRPWRL
TGLDPAGPCFRNLPPEYKISPTDAMHVDVIHTNIDGFGIAEPLGHVDIYV
NGGEFQPSDIPYIPCLVICSHLRAIFYWWLAVEHPKKFIAMTCDSVQDAR
FAKCFNNSITNYMGLDTDFGKPGIYYLATHNEFPYYRGKAGLKSENEIYT
SVIKQINSDDGFVV
aedae-Q8ITU8: Aedes aegypti (Yellowfever mosquito) (Culex aegypti) lipase-like protein, 1 reference(s)Aedes aegypti Show
MNHPDWLNDTEWEPTKENIILVHGYAGGDDTLPIAVLRDAYVNHGGYNVF
LIDWGALGQPPCYVAAVYNIRPIASCLAKTFMRLRALGLPAEKTTCVGHS
LGAHICGLMANYLNFRLERIIALDPARPLVKPGNMNRLDSGDAKSVQVIH
TNAGHYGEGGRVGHIDFCINGGRRQPYCGNSTNINLCSHIWAICYLAQSV
YDGMEPMAEPCHRRCPTNVLLPPSGRHGRGRFGYAIGYAIPMGQKTPMSA
FGSYCVKDTSPPFCSTNPAIPGDKRCCI
anoga-q5tmj8: Anopheles gambiae str. PEST ensangp00000028377Anopheles gambiae Show
MVNNTYAGALSSRDVDNHEWHIAADENGNMRLVSYAVPYQLDGEKPKRDF
VPERDTRFLLYTASNPEVPHVLRNGDIASIQSSPFNPNNPTRMIIHGWLG
TQDSEINRLTRSALFFGGNYNVIYVDWSVGSLDEFYPNSRQLVYAVAAAA
SNMLDYLARYGQLNKRDVVVVGHSLGAHVAGNVGKWQSGAIPTIVGLDPA
LPFFAGDAPDRIMASDADYVEIIHTNGGVLGFMEPIGDADFYPNYGRVQP
GCGADVGGGCAHARAVHFYVESILSRHGFVGEQCESFQNIRDGTCAQTGV
SSRMGGEPPNAEGAPEGIFFLQTANSFPFAVGC
anoga-q5tnf6: Anopheles gambiae str. PEST ensangp00000027022 (fragment)Anopheles gambiae Show
SCRPVPVSVKKGRSSFTIGNCVWVVDRPCPDSDIRFYLFTRSNPDDRQYI
HIDETWEQSNLSSSYFNPSHPVKVIIHGYNADMFLTPLINMKGEYLSRAN
YNLFYVDWSDLAHGPCYPSAVHNTRHVGKCIGQLVQRIIDAGTDNIHLVG
FSLGAQVTNYVSTTVRPFRLKRITGLDPAMPLFITAAPDDKLDPTDAEFV
DVIHTNALVQGKIERCGHVDFYVNGGILQPGCWGSGQNPMACSHHRAPDY
YAESIRSLTGFWGWSCQSYVYYLLGFCPQNNAQVIAGEDCPTGTEGMFMI
TTNPASPFAIGRWSGFSIPQKKDAILNKHGLNRDPFISDIDQWGKLDSSF
NNVDHFPTPYSQDP
anoga-q7pft8: Anopheles gambiae str. PEST ensangp00000023853Anopheles gambiae Show
MEKHFLLGLVLLAFKLSVKCVVINPAVAYHLEYDLADNVDWVRIPTMVGE
WIWTHRRSVNAMMKQHRSDEPPVKIEFLLHTRRDTADEGHLLEVGNVDSL
LGSNFRSDLPTRIIVHGWQSSKSSPLAESIRDTYLLLWDYNVIVVDWSDC
ALGWNYVRAVGCVPVVGQTLARLLDEFQQHAGLMMENVYVVGHSLGAHVA
GIAGKRVQNGQLHTIIGLDPALPLFSIHEKENRIDHQDAMYVEVIHTGGG
LLGFRDPIGTADFYPNGGSHQPGCGLDVVGLCSHTRAWELFAESLLEPVE
NLVASRIESLEEIEQLPPVEMDSIGLGDYVVERVKMGGEPSNAGHAQGLY
SITTSDKSPFFAKIG
anoga-q7pvc0: Anopheles gambiae str. PEST ensangp00000017875 (fragment)Anopheles gambiae Show
VPDSDGRLHLVNTNPYALPDDSFVPNFVPEQDLIFRLFTRSNPTTPQVLE
FGNAGSIAASNFNPAHPTRFTIHGWNSNGNDGMNTNIRDRYLSIGDYNMI
SVDWSAGAVNPNYIAGRNAVGPAGAAVASFIDQLVAAGASTDNIYVIGFS
LGAHVAGNAGKGQNGRVNTIIALDPAGPLFSLGQPDAVSPADGRYVEMIM
TNGGLLGSSTPMGQATFTPNGGRTQPGCGTDIAGGCAHGRAPAYYAESIT
SSVPFRATRCASMQEVVEGNCTPSGPDANMGGEPSNYGRGVTGVYSLTTN
DGAPF
anoga-q7pw35: Anopheles gambiae str. PEST ensangp00000024444 ensangp00000025831 ensangp00000016498 (fragment)Anopheles gambiae Show
EVYQSRETAKSSRRVSARVVATRISTMKSLKNPRVWVGMKPVRAHLDTAK
FVLFYGPKFEDHETYSLEKAEDILQHSRFDKSKKTVMYFHGYIESMEVES
VHVIADAYLKRGDHNIIILDWAQLADGNYLLEAVPNCKKLGSYLGSVVLR
MINAGLNVDKLHLVGHSLGGQLAGYVGRTVIAQSEKRVKLNRISALDPAF
PPFYPGIFATALSSKDADFVDVIHTDAWLYGAPVSTGTADFWPNNGKTLQ
PGCPKRNYKLLTDNAKAFRQNSSEDLCSHRRSWWFWAESVAESNVASFHS
VKCKSWDDFKDGKVDRAAPIVHMGIDCSS
anoga-q7pw37: Anopheles gambiae str. PEST ensangp00000005241 (fragment)Anopheles gambiae Show
GVLDLNFFRCMWTKNYECPHEDIKFFLYTPTFRKGRIIDMNEPKSIFKVG
FKTNQQTAIIIHGFNGTQTSRHIMFLKDAYLSRKFNVFAVDWEVLSQYPC
YFSSLSNTKLVSQCTAQLYSFLTFAGCTSKQITCVGHSLGAHICGMMSNH
LTKKQYKIIGLDPARPLIEKHASKKFRLTRDDARSVQIIHTNAGLLGQSS
FSGRVDFCINGGQVQPYCEGDRIKQARCSHFLSVCYLANAILAARPMRAF
RCPSGCV
anoga-q7py64: Anopheles gambiae str. PEST ensangp00000008468 (fragment)Anopheles gambiae Show
DMIFRLFTRANPTQPQILQLNNAASITGSNFNPAHPTRFTIHGWNNDGSH
FMNPLIRDAFFERGDFNVITVDWGVGAINPNYIASRNLVGPVGNTVSLLI
DQLIATAGANPDNIYIIGYSLGAHAAANAGKAQNGRINTIIALDPAGPLF
AFGQADAVSPADGRYVETIMTNAGLNGINTPLGQANFYPNGGRTQPGCGT
DLGGSCAHDRAPTFYAESVRAGTPFRAMRCADHGQILAGSCTSSGPDANM
GGQPSNFGRGVQGVYYLQTNAASPFAQ
anoga-q7pz17: Anopheles gambiae str. PEST ensangp00000017945Anopheles gambiae Show
MQIIISHGLINGQCESSWENHNFLWATHIKMSDHFREPLSSWEFAQNEGI
RDIQHLLGNRQDEPAPLFNADTDVIFTLFTRNNRNSGHRITPGNAGTLGP
HWNGGRQTRFVIHGWNNNGGSEVNVLIRNAYLDRADINVIIVDWGVGAQN
PNYVTSRNHINAVGLTVARFIDFLNQSGGLAFNNVYVTGHSLGGHTAGIV
GKRVTRGRLNTVVALDPALPLFSINDPANRVAPGDANYVEVIHTNGGLLG
FDLPIGLADFYPNGGRSQPGCGVDLAGTCAHGRAFQFFAESVRTAQSGFN
SIRCGNYDQILNNNCVSSGANARMGGEPSNIGRGVNGVFFLTTNANSPFA
RG
anoga-q7pz18: Anopheles gambiae str. PEST ensangp00000017991Anopheles gambiae Show
MMKLFALLILCVAAASAASLSAPAPDSWMLIPDGNGRLHLANLNPYNMDE
TVPEPHFTAATDTIFRLYTRSNRDTPQVVGLNDAGSLSGSNFNAAHPTRF
IIHGWNNDGFSEVNMILKDAWLDRGDFNVFTVDWGVGAQTINYPFARARV
GAVGNVVSTFINFLQANTGITFASVSIAGHSLGAHAAGNAGFFQFGRLNT
IFGMDPALPLFSLDSNDRLTLNDAQYVESIHTNAGLLGFDLPLGQASFYP
NGGRTQPGCGVDITGACAHGRAYEFLAESIVSGGFTSVRCGSYDEILTGN
CSVQGASRPMGGEPSNFGTGTEGVFTLSTRAAAPFSLG
anoga-q7pz19: Anopheles gambiae str. PEST ensangp00000017989Anopheles gambiae Show
MKAATVILSVLGLVALGSAAPVESIHPWALIPDGNGRLRLINVNPYDVPK
GDNEVEPLFDPLTDVVFRLYTRRNPVHPQVIRWNDAGSVSGSNFNPAHPT
RFLIHGFLEGEDASLHWSIKDHFIRVGEFNIVNVDWGAGSQTINYIAARN
RVGAVGEVISRMINTIVSATGTSRNNINLIGHSLGAHVAANAGKHQNGQL
NTIIGLDPAGPLFSNGQADLFGANDAQYTEAIYTNAGLLGFDQPLAHANF
YPNGGRSQPGCILDVAGICAHNRVNNFYAESVSSSVGFRSTRCANHAEIL
QGRCTPSGANANMGGEPSNRGRGVNGVYFLTTNSNSPFAQG
anoga-q7q2h9: Anopheles gambiae str. PEST ensangp00000017060 (fragment)Anopheles gambiae Show
SVIAQDASFYRNLITFMIHNSEQNATLNVASDFTDFEALGCYSSDPFAII
VHGWKESCQTEWLVDMISNLSNVRAGCIYCMNYNNFSRHDDYFGLVRQFL
PISEVLVEKLQQLENFGYDFDEGYMFGFSYGAHLALDSLRRFGPGKLAAL
DVCEPAGPGFDGDQKYREKCPTEAAKNVQCIHTSDNYGTNVRKCHQNWNM
GRCGKSQDAAGPYPKGSHGLCPYIFNSAFKHDFLAMPNKQGCETKRLAPA
WPKGFRMGYFMDRKSDVIGDLFAATSKEYPFFDNTFANEVNEV
anoga-q7q2s9: Anopheles gambiae str. PEST ensangp00000010825 (fragment)Anopheles gambiae Show
SVQVHHHHHPHHPHCRDCFRDCPLDSLGSEMKPHYMLLLAVLVGFHATGS
SGQSSNGEAAGDDPDLDDMEYERDNDGESLIPKPVVVRSDLGDPVPTVQI
PNKAGEFVTMTRMDVQECKSNASYYEATKYVQCYLYRANDTADRHEFHFN
GLSSIVAAGYKRTLPTAILVHGWLGSSESVVIDPLAKALLAQENKNVIAV
DWEQGASTLLYPVARYRVPKVANLVAALIDNLVAGLGQDINQIGIIGHSL
GAHIAGIAAKRVRSGKIGYIVGLDPASPLFRLKKPDERLSADDAQYVEII
HTNGKALGFFSNIGQADYYPNGGVRQPGCGFSLTCSHQRAVDFFKESLKI
SNYYARRCDGIANLGPTCSTDRTVLGGMIWKSSKPAGVYYISTAPNEPFL
RSGTVELRRSASWILLLLSLASTYIRIA
anoga-q7q3r2: Anopheles gambiae str. PEST ensangp00000012348 (fragment)Anopheles gambiae Show
QENKNVFNTSSCLEKPYRCPHPRIKFYLYTRRTQHTPELIDVLDPESLYY
THWNPSHPVKIVIHGFGGGRNLSPSPDMRKAYFTRGNYNIIIVDYGSAVT
EPCLNQIEWAPRFGSLCVSQLVKYIANHPRGVPPDDMHLIGYSVGAHIAG
LVANYLTPAEGKLGRITGLDPTIFFYAGSNNSRDLDPSDAHFVDIIHTGA
GILGQWSPGGHADFYVNGGTSQPGCASSTIFQTLACDHTKVTPYFIESIN
SERGFWAGPCPTLISYLLGWCEPKDSEYVLMGEHLSRQARGVFYVTTNAK
PPYARGFPGKNRRTAKTSEYAGVRR
anoga-q7q9q5: Anopheles gambiae str. PEST ensangp00000009935 (fragment)Anopheles gambiae Show
SPEQLLEFSKQSIIGLPAEAIAATINQICSVALLSNATASENEVNITDMN
YILMTEDNNVTIPLLESDDLWKNELFNKSYDTVILVTGWTSNVNEPNRAI
DTIYNAYKARGGYNFVVIDTAEYVDTLYTWSAFNTNDLGEGLADGLKGLI
KYVPLEKIHLIGHSLGAHIVGGAGRYFQYKTNKSIPRITGLDPANPCFNE
GESLSGIQRGDADFVDIIHTNAKVLGKRDPIGDADFYPNGVVSVQPGCLD
PACSHKRAWELYAETVYPETEKSLLAVKCNSLLSLNTGGCVSNPIPLGFA
CPKTAKGNFFLKTNDKSPFAM
anoga-q7qa39: Anopheles gambiae str. PEST ensangp00000003833 (fragment)Anopheles gambiae Show
TRVIVHGFCNCQHSDFCQSVKDALLYANDVNIISIDWSDTAGLLDYILLR
LRLDQVAASLAGFVDFLHNTTNLDLSQLHLVGHSLGAHLAGLSGKRVTSG
RVGAIIGLDPAGPLFSSRDPKSRLDGTDAAYVEVIHTNGGTLGMYDPIGT
ADFYPNGGKHQPGCLPWIFGSKRANIGLSCSHGRAWELYAESVYTPVGFK
AVPCDTVQQIEGSVCRIDLPTVDMGGEPVNKTKSGLFVLSTNSRFPYARG
anoga-q7qgx4: Anopheles gambiae str. PEST ensangp00000012614Anopheles gambiae Show
MFVRQSIKRLALPVAVAMVLMLVHHAHPVSADRFQDNIFFNYYNSSGDLV
HIYNLAENNTYEYDDECHPGAKYAIVVFGWKIDCEKYFVQDLIRNLTEYR
GGCVMCMNYDRFAQLPTYARLRRNFKDIYGVLKQKLEFLEKEGFSPDNGF
LYGFSFGAQVALAAAKEYGTRKLKEIDACDIVGTGFDTTDVNAPNHRTAA
KNVQCIHTSRNYGTRHRTSCHQDWIMGDCGINQLAAPLSPWGSHGVCTLL
YNAAFEHDFLARAKPSNCTSESEVRSWPEGFKMGYNEQRKATVRGQLFAP
TFAEFPFNVNVTANSNTTTTVRPPASANDIEQLPGFEFRSAANELLLEEE
GENNESDEQDES
anoga-q7qhc0: Anopheles gambiae str. PEST ensangp00000012504Anopheles gambiae Show
MQPLIRLQTSASARRQNPDTGDTLFVSDKKHLRASHLNRTNPLVIYLHGF
SERAPGGAGESSKQMKDALLAADDYNVVLVDWSPLTALPWYVNSVQNGPR
VGRYIARFVRFLVLSEFPLEKIHLIGFSLGAEVAGFAGKTLNEWGLKLPR
ITGLDPAFPLYVFERASQRLSPKDAEFVDVIHTDGGLLGYPWPLGHVDFY
PNGGVPLQPGCAQQELAKNRWLGVFIGCSHARAWQYFAESLTRPQGFLCE
RCEPTDAPATGAASRSTRDTNNCTMTREVFMGMYTDRTLRGKFYLSTNPQ
PPFGKNLMPHEQQQKQQQLPVQRKS
anoga-q7qj95: Anopheles gambiae str. PEST ensangp00000018475 (fragment)Anopheles gambiae Show
GCKPAEPFVVVVHGWTEGCSNTQWVRDTLNNFIIHRKGCILCLDYSVIAD
GNDYFTVAKLMEPIARTLEKKLRQLFTFGIAPASGMVYGFSLGAHVAFQA
GRNLAPQKLGRIDACDPVGIAFDKNDTYTALSVTDSATEVQCIHTSSDIG
TTRRDCHKDWIMGYCGWVQFAAGLKTSHELCPIFYNAAFWFDFKAVYNPY
VCPTSRAVSSWPAGFKMGY
anoga-q380n7: Anopheles gambiae str. PEST ensangp00000025781Anopheles gambiae Show
MVKLVAFLAVLLCGNLAAATSADLISVLEQLAEGPLARLLDLNIDPPPRT
AGFSTLLPQKSIRLTCTKTREPRFQEILVGDVNLQSKLNFSLPLTIAIHG
WQERNLSTYSALTMPYLRFANNTNYCLLDWRAYSEFGYQIAARQSVPLVA
QYLFGFLQNLSLLYFPLERVTLIGFSMGGQIAGLTGKLLPNRIGTIYALD
PAGPLFSHPVDIGPKRRLDASDAQYVQVIYTSRYTAGFGKVLDGAQNFLP
NKGYHPQQPCNAKGDGLSELAGALQCSHRYAVSLFVSSLDPNNPIIGKKC
PTIFGARVCLMPTKDRLGIYAQRIRGDFYL
anost-Q8I6P1: Anopheles stephensi (Indo-Pakistan malaria mosquito) putative salivary lipase, 1 reference(s)Anopheles stephensi Show
MLYCSRLLRGFVLMALLASALERTTVDAQNASFYTNLITFAIHNSEQNVT
TTVVSDFEDFEALGCNSSDPFAVIVHGWKESCQTEWLVDMIGNLSSVRAG
CIYCMNYNNFSRHDDYFGLVRQFLPISEVLVTKLHQLERFGYDFDAGYMF
GFSYGAHLAFDSLRRFGPGRLAALDVCEPAGPGFDGEQQYREKDPKAAAK
NVQCIHTSDNYGTHERNCHQNWNLGRCGKSQDAAGPYPKGSHGLCPYMYN
SAFEHDFLAMPNKQNCETKRLAPAWPKGFRMGYFMDRESDVIGDLFAATS
REYPYFDNTFANEVNEV
antya-q6l5z4: Antheraea yamamai (Japanese oak silkmoth) lipase (fragment)Antheraea yamamai Show
RGVDEEILNSRNGANNQYWLFTRQNPTNAQIITNGNANSISSSNYRANRP
TKVVVHGWNSNGNSNINPMIRDAFLANQDCNVIVVDWRALANSNYITASN
GVPGVGQFLGNFLIWLFNTAGGNWNQLHLVGFSLGAHVVGNAGRIAGGRP
TRVTGLDPAGPRWGGNNDALNTRSGQYTECIHTDGGLLGINDRICHTNFY
PNGGNNPRPGCWVSTCSHSRAYQLFASTVRSNHLLGRLCGNFNQAQNNQC
TGSTLHMGNAILTKRGNGIYGLTTGSSWPF
bommo-q2f644: Bombyx mori (Silk moth) triacylglycerol lipaseBombyx mori Show
MLKLITLLAFAFAACNGDAIQNLERFGSLNKYYYYSNAQRNSITLTEDHF
PTGNDTAAPFNNNWDIVVIIHGHSGTATTTINPIVKDAFLTSGDYNVIVV
DWSSFSLSTYSTAVMAVTGVGSSIATFLKNLKLPLNKVHIVGFNLGAHVA
GVTGRNLEGKVARITGLDPSARDWENNVLRLGTNDAQYVEVIHTDGSGVN
KNGLGVAIGHIDFFVNGRLVQPGCTNNLCSHNRAYEVFAATITHGKHYGN
QCSTEAEITANNCRGFIVEMGTAKLVKHGSGMFRVNTGMRYPFHL
bommo-Q8MY66: Bombyx mori (Silk moth) (and Wild silk moth) Samia cynthia ricini (Indian eri silkmoth) lipase-1, 1 reference(s)Bombyx mori Show
MPDGEGVPHLVDLEEPAEEDILMSRNGANNQYWLFTRRNQNNHQVITNGN
VNSIRNSNYNGNLPLFVIVHGWNSNGNSAVNTMIRPALLAVSDCNVIVVD
WRGLANGLYNTAVNGVPSVGQFLGNFLVWLINNGGGNWGRVHLIGFSLGA
HVVGNAGRQAGGRPNRVTGLDPAGPRWGGNNQALNRNAGAYVEAIHTDGG
LLGIFDRIAHGDFYPNGGRNPQPGCRVSTCSHSRAYELYASTVRHNRFVG
RLCNNLNQAQNNQCSGGTFNMGNAVFGKRGNGIYGLRTGSSWPF
culqu-q6try9: Culex quinquefasciatus (Southern house mosquito) putative salivary lipase (EC 3.1.1.3)Culex quinquefasciatus Show
MWSIPALLVVFVAGLATGQAFDFSNFTTEAALASFIDGISTGLADMAGDL
IQTVMDNETIDQEVTFWCGRRGYSSLQQTFVNDNSIASKLDLSKPVAIIT
HGWLSYANVTWVQEMAGNYSKYVDSNVCAVDWSRYARYGYAIAAKRNTRL
VGNYLTLFMQFLTRNGITPSKMTLIGHSLGAHVSAYACKNFSSQVKELYG
LDVAGPLFTQPIDVGTKNRIASTDAGYVQLIYTTRYLLGVGDPIGQANFF
PNGGYHPQPSCLLPMLTYADTYVPIACSHSHAHQLFTLSLNPAFMYKAKK
CGTYPSYLLGLCLFNSNDVLGIYSKKLLGNFYFDQKLLYPFV
drome-CG1986: Drosophila melanogaster (Fruit fly) gene lipase, 1 reference(s)Drosophila melanogaster Show
MPGHVNHLLLLGCLLCLLGDVPRIEAFHRWSPMMKAFRYLQETMLRNSLE
RAHLNHGIVFECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLH
GWNDQGSKDWVQELLLTWTLFDSNYNVCVVDWGNLSQNDYKSASMSIFDV
GLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQI
IGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHAD
FYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFV
GYECGSYREFAAGYCDGNRKARFGIHSQRRAQGSFYFRTAPQQPYVPRRQ
TNWLSGVGRMSSSKVSQVSQSPLVLRLWTNSWRRRERARERQRRDRDRES
DRCA
drome-CG4267: Drosophila melanogaster (Fruit fly) gene lipase, 1 reference(s)Drosophila melanogaster Show
MISQLGRISIMSAVLLAFAAIVFASSSEKTELDPNATCNYTLVKKKTLGV
DPSFWKKFFKHLIPFTSSRGKMQFILFKRDFADCGRELFVGDVENLRNSG
FDARHQTRIVIHGWMSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNV
IVCDWSKTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIG
HSLGAQIAGSAGKQIMPYRFNTIYALDPAGPQFREKSDEYRIDASDASYV
ESIQTSVSFGFEQPVGHATFYPNYGKNQKKCYVYGCSHKRSHDYFIESLT
SPAGFWGPRCERHDDGTWLLLMSDGEFRMGGEPSIPKNGTFYVKTYSKPP
YAMGHRWQTEPPPREDDIENSTEE
drome-CG4582: Drosophila melanogaster (Fruit fly) gene lipase, 1 reference(s)Drosophila melanogaster Show
MMMRMRNRGGKRLQANYFDTQMPLLSSGLMSPGQLPILDEQHGRQEQLER
HYLAHGPSSVEQQLLRLQPDYKLLYSAEHHTYFHLHTLVPQDNANRQTGP
LKSEKESPHRRLFQQVVGNTLTAAFGLNVMNKGDQEQNQQFTSEPVNLYD
AASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFT
VDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSM
GAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVL
HTSVGSYGFDRPVGHVDFYANWGSQQPGCFWHECSHWRAFMLFAESLARD
QATGFLSQGCPAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQ
GVYYFQTNDQPPYVLAQNASSKRAAHIQENKK
drome-CG4979: Drosophila melanogaster (Fruit fly) gene lipase, 1 reference(s)Drosophila melanogaster Show
MGSLTGMHISHWLLWTCLLLLGAAGTDASVDYFAYAPGKCEVSISDVIQG
MITTEAGVILGRPRPSQTKLLRYDLYTPLNPEERQLLRPGDLTMLRNSHF
NPKWPVRVSIHGWAGKSVTCSNAAIKDAYLSRGNYNVIILDWSRQSLDIS
YPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGK
LLRPHRLGAIFALDPAGLTQLSLGPEERLDVNDALYVESIHTDLTLLGNP
STKLSHASFFANWGLGQPHCPNATATEFDFVCDHFAAMFYFAESVRQPKS
FAALRCSSAKSVLSATCNCNVGGSEKYAVNTCTGNEFMGGEPAVPKRGIF
YLSTRPQSPYGTSDGLVHIKRPRPSTIRETANRRSIG
drome-CG5162: Drosophila melanogaster (Fruit fly) gene lipase rh13728p CG5162, 1 reference(s)Drosophila melanogaster Show
MGRVPAKMHTLLALLLQLLVASIHAIEWSLPDVINSIGNVGTSIVDPSLL
PTPQGLLEGSKQLIAGYPFEFVSNSLNVICSQALASNKIKSKYSPDINKM
NFQLQTACEKKNFPLTSPESMWKSPLFDVKKKVVILATGWTTTVNGSDTI
EVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLL
DLVPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNE
GEALSGLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGCFS
VTCAHARSWEYFAETVFPGNERNFMATRCNSISKLRDFRCPGDEVPMGYA
VPQNIKGNYFLEVSASAPFGMHASVVRSAHLEHCGLCPESTSTTEVPSTT
TTGKPGSWFSG
drome-CG5665: Drosophila melanogaster (Fruit fly) gene lipase close to vitellogenine and yolk proteines?, 1 reference(s)Drosophila melanogaster Show
MHFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVVILATGWTNTVNESSA
ISMISKAFMCRGDVNFVIVDAADYVDTFYAWSALNTDLIGEHIGVGLTHL
IELTPLRNIHLIGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFR
REKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQPGCL
TIGCSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVSPMG
YRMNPQARGIYYVDVNGWPPYGRNSENTVDPRLKTCYLCRR
drome-CG6271: Drosophila melanogaster (Fruit fly) gene lipase, 1 reference(s)Drosophila melanogaster Show
MKTFLILAIFALAASAYALEESERVNGENGWYVPQQDGSFEWVDMDVAEE
WMEAQEKLEGRGLTTVPVNFYLFTPKNPSSSKHIYATTKSISKSNFNPAH
PTRFVIHGWTQSYLNSMNSDIRKAFLSKGDYNVIVVDWARARSVDYATSV
MAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVAGYAGKNTDGQ
VHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKG
AFYPNGGKTQPGCPLDVTGACSHGRSTTYYAEAVSEDNFGTMKCGDYEEA
VAKECGSTYSSVRMGADTNAYMVEGDFYVPVNSKAPFGMIN
drome-CG6283: Drosophila melanogaster (Fruit fly) gene lipase, 1 reference(s)Drosophila melanogaster Show
MKVFFVLAALLAAVSALPIEERVNGENGWFIPKLDGSFEWMDMQDAEDLL
ANGAQMEGRISTNAVNFYVYTKSNPTDGKEIKAKSGSVEDSHFNKDHGTR
FVIHGWTQRYSDDMNTRITKAWLSKGDYNVIVVDWARARSVDYASSVLAV
PGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVAGYAGKTVGDKRVH
TIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFLKPIGKGAF
YPNGGKSQPGCGLDATGSCSHARSVLYYAEAVTEDNFGSIKCHDYEDAVA
KNCGSTYSSVRMGAITNAYMVEGDFYVPVNSEAPFGKIE
drome-CG6295: Drosophila melanogaster (Fruit fly) gene lipase, 1 reference(s)Drosophila melanogaster Show
MMKLFLALAFCVLAANAVEVRVNGENGWYVPQADGTMEWMDREFAEAYLE
TKNRMEGRNVLNPVTFYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRF
TIHGWSSSKDEFINYGVRDAWFTHGDMNMIAVDWGRARSVDYASSVLAVP
GVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKNGQLHT
IIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFY
PNGGKSQPGCGVDLTGSCAHSRSVIYYAESVTENNFPTMRCGDYEEAVAK
ECGSSYSSVRMGATTNAYMVAGDYYVPVRSDAPYGMGN
drome-CG6296: Drosophila melanogaster (Fruit fly) gene lipase, 1 reference(s)Drosophila melanogaster Show
MRLCLLVLGCVIAASAWPVDQLSVRDHGINGWFVPQREGGLRWIGKAEAE
RQLEYYEAQEALEGRLSTNTVNFYLYTLQNPSTGQQIKATQDSIDGSFFN
PQNPTRITIHGWNSNYKDGVNTRVADAWFQYGDYNMIAVDWLRGRSLEYA
SSVAGAPGAGKKVAALVDFLVEGYGMSLDTLEIVGFSLGAHVAGHTAKQV
NSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQTNGAILGFGQP
IGKASFYMNGGRSQPGCGIDITGSCSHTKAVLYYVEALLWNNFPSIKCES
SVDANKNNCGNTYSSVFMGASINFFVAEGIFYVPVNKESPYGLG
drome-CG6431: Drosophila melanogaster (Fruit fly) gene lipase, 1 reference(s)Drosophila melanogaster Show
MDWKNLRNSGALDLNVLRCFLRDKNYCPSPHIDHRLYAPNGPRRGTPLNV
KNPITLYKGGFSKHRETVFIIHGFNGTAIDIHLQFLRDAYLSRDFNVITV
DWRPLTRYPCYLHSLINTRLTAQCTAQIYAFLTHYGAVRERITCVGHSLG
AHICGMISNHLTRKQYRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLH
TNAGFLGQEDNSGHLNYCVNGGRIQPFCKGNPIRKSRCSHFLSICYLATA
TFKHNKFMGVPCPNGCLNLSGSKRLPVSGKVNPFEFASLIREYHIGNDAP
DE
drome-CG6472: Drosophila melanogaster (Fruit fly) Lipase domain-containing protein, 1 reference(s)Drosophila melanogaster Show
MSEVGCDREVICELKRKVSSGQAGSPIFYSAAPRGSCSTCCAIKEREDIK
FMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQ
SSQELKDAFLRRGNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLR
FLVDKGYPAKYIHLIGFSLGAEVAGFAGKQLQEWGIKLPRITALDPALPL
FEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPNGGRPLQPG
CAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMFGIC
REPGGGPAFMGMGADPRIRGKFYLDTNDAKPFGRNSRARAIVSLAPRLPI
AYKLPPNATRQPSVSRWANGQKEQDNEDEDNNALSNNIDRFSLT
drome-CG6675: Drosophila melanogaster (Fruit fly) gene lipase at29263p, 1 reference(s)Drosophila melanogaster Show
MDDYDAEMGEFMNALPNLDDTPYGLGQRSDISTEPEEDDILASLDDEYEE
AKHCVWNTCDKDLSESRGIGKFLDLPFIKKIASNLNPFGSKKLRMHFYLF
KREFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVK
NAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQF
GADFDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTE
FRIDPSDAKYVESMHTSANFGFRRPTGSATFYPNYGAYQHSCYYLGCSHI
RSYQMFAESINSPLGFWGTPCIRDNGRWQCDYSQRQSIQMAGEPSIHKEG
IFYVKTSSSDPFALGKQ
drome-CG7367: Drosophila melanogaster (Fruit fly) drome-CG7367 gene lipase, 1 reference(s)Drosophila melanogaster Show
MSSNALACICNVINPCRNEVSTTFVVVQWLITGFAALAQVVRPVLLLFGI
RGEVALNQEDYNKTWIYMPNGQGKPEVAYLVEPPPENRINLPQLIKFELY
GSDSSSSADFWIDENNFEFPQRHKRDTWQEMAEKFNPELDTKILVHGWKS
STMSNSIQSIRGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRAV
AKLIDLLVEEKDADPNRIHLIGHSLGAHIMGYAGSYTKYRVNRITGLDPA
RPAFEDCIGPENHLDDTDANFVDVIHSCAGYLGFRKPIGMVDFYPNGGGP
PQPGCKELSQIFSKFWELVSISYKQNWEISFSFSAGCSHGRSYEYYAESI
NSPKGFYGVPCSGLDELKGKNCTGGKILMGDPVPREARGIFFVKTANKPS
YALGIDDLWSN
drome-CG9966: Drosophila melanogaster (Fruit fly) CG9966 CG31684 gene lipase, 1 reference(s)Drosophila melanogaster Show
LDLNPWNFQPPRPLKILIHGYTGDRDFAPNSYIRPVLLDHEDVYVISIDY
GPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGG
QVAGQTANYVKRKMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTD
VFGRGYLRAAGHVDFYPNFGAKQPGCMEENMQDPSSCNHERAPRFYAESI
NTTVGFWARQCSGWLLQLLTLCPTTGAQALLGYHVSDELRGSYFLQTASK
SPYALGKMQDVDNRQTLAKFHLNFDHNEIDDDYEPQLLEAFLELEAVKVV
VKMDESELDKR
drome-CG10116: Drosophila melanogaster (Fruit fly) gene close to Vitellogenine and yolk protein gh07181p, 1 reference(s)Drosophila melanogaster Show
MQTGVQLALFLTLTIAAVYGETGFFLNTRRVQENAQPIEAEVEALVRSSF
YAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNIISVDLSEANDETE
IIDSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQDLGRQL
SQITALDPSSGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPN
GGQTQPGCTTDSCSHERAFELLAEMWSPENDFVSARCGSVETLSASSCRW
STHKMGQKQEEEQPASGIYFLETRQSSPFSRGAYFISFL
drome-CG10163: Drosophila melanogaster (Fruit fly) cg10163 protein, 1 reference(s)Drosophila melanogaster Show
MRAQFTMQKSTAQMIIAVCLICQSLAVEDKDKATNPLNIDSVQKHNVKLL
SEQLNRGWRAFCDAPVDEGVMSLFQGINPSDARLHVMTITNQSVELPIKS
ISQIKDFDINPERKTLIYVNAFHTADSYFSVQEHLTLLQNSRRDLNVIVV
DFAKDVAQLYYAVRHHLSVNGYFVYKLLRALKDAGIAVQDITLAGHSVGA
NIAALGAQLFAKENKQLVGQLLAIDPATMCRTTDILVKQSVALRVVVLHG
EGDVFGVRVPLGHIDIYPNGIGYFPRRKLQPGCESKICSHMYPFILFMEA
LIEGVMIPATKCESWAKFRQGDCNFQNTINIGLIYPANAKGLYFCMTQPN
PPFTYMEHGLRYKARRPEKSSEKNRIKF
drome-CG10357: Drosophila melanogaster (Fruit fly) gene lipase, 1 reference(s)Drosophila melanogaster Show
MAKTSLCLVPILCQFLGLHAALLDSLLNQSTIYYLKPSADVSLENVEQLS
SVESVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLDYP
SSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYF
NGSLGRVTGLDPALPLFSSRSDDSLHSNAAQFVDVIHTDYPLFGDIRPRG
TVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMP
ENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRRSW
NAVNLGISRWQQLAVDRKSTENASWMWVAQVLQLDQVVRWSMVGDHPSFK
SIIDHCIVPQIDFRLH
drome-CG13282: Drosophila melanogaster (Fruit fly) gene lipase, 1 reference(s)Drosophila melanogaster Show
MHWRLVIGLLLLASFNRETIGKRFLNLKPIPIQHEDESSTEGSTNPTPTS
TTTPSNRDITIGPCKWAIGRSCPDPDVKYYIYTRHNPMDRQCLHIDESLE
KSNLTDSYFNPRYPTKIIIHGYNSDMFLHPLQQMREEYLAKADYNIIYVD
WSILSPGPCYISAVHNTKHAGTCTAQLVERLVETGNTDIHVIGFSLGAQV
PNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNA
LVQGKMERCGHADFYMNGGIMQPGCNGQKINSFACSHQRAPAYFLESIRS
PKGFWGWACSGYISYLLGMCPPTNFLLEAGENIRPTTRGMFMIDTNDSSP
FALGKWTDLPTLGAKQPQWRVPTQKLKAPPNQGVDPLLHHIDQFGKLAAN
FNNLQMWPTEQDPYEHWTSFSPEQKENDSDGDSVEEQDPVEFIEPDDRQM
ISTEARPTQSWWDYRRNLTYGFMEDNIFSVPTVD
drome-CG13562: Drosophila melanogaster (Fruit fly) cg13562 protein, 1 reference(s)Drosophila melanogaster Show
MWEKVSAGRAYHVDVFVYEAHQQRIKYDAQKTMKVMFYKNNTKTMETSAY
DDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRGGCVIC
IDYSVVASSSYMRLYTNFDTLTGAISSIILTLFRQGFDPKRGYMFGFSFG
GQLASAVGRSLRPHHIIESIDTCDMAGPGFDPIAVDHSKAGKHVQCFHSS
RDKGTFVYSCHRNIMLGSCGLKQPSVASQLHLGSHGLCVDIYINTFDYPF
YAVNYTPPECFTWQKTAKIPDGYTVGYEENFDSQVTGQIFVPTSLHYPYN
LSKKQLKLLTKGGA
drome-CG14034: Drosophila melanogaster (Fruit fly) gene lipase male accessory gland protein, 2 reference(s)Drosophila melanogaster Show
MNSILVLIGFSRVMLVAGLDDMNCFSLQNEICPNANISFWLYTKENQEGT
KLSVFELNRFEFYHHKPLKVLIHGFNGHRDFSPNTQLRPLFLTQDYNLIS
LDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLG
LGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDV
VHTDVTMLGLLDAVGHVDFYLNMGVSQPNCGPINKMETHFCYHNRAADYY
AESISSPSGFYGFYCPNFKSFAKGICIPDKNIELMGFHVDPKARGRYFLD
TNNGPPYAKGENFTSISRQLKGRTFVNDDIIDKLIGT
drome-CG17191: Drosophila melanogaster gene lipase, 1 reference(s)Drosophila melanogaster Show
MRVFIALAALLATVSALPIEERVNGENGWYVPQIDGSFEWMDKQDAEELL
NRNSLIETRSNDVSFYLYTKHNPTVGKEIRADASSIEDSHFDKNQGTRFV
IHGWNGRYTDGMNVKITRAWLSKGDYNVIVVNWDRAQSVDYISSVRAVPG
AGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAGKQVGGKRVHTI
VGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFLKPIGKGTFYP
NGGRNQPGCGSDIGGTCAHGRSVTYYVEAVTEDNFGTIKCHDYQAALANE
CGSTYSGVRMGAVTNAYMVDGDFYVPVNGQAPFGKIE
drome-CG17192: Drosophila melanogaster gene lipase, 1 reference(s)Drosophila melanogaster Show
MRELFFLAALLVAGNALPIEERINGENGWFVPQEDGTFQWMDKKDAKELL
ENISPLEFRSNEVSFYLYTKQNPTEGQEITADASSIVASHFNKDHGTRFV
IHGWKGKYTDSMNVDITKAWLSKGDFNVIVVNWARSQSVDYAMSVRAVPG
AGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGYAGKQVGQKRVHTI
VGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVKGFVKPIGKAAFYV
SGGRKQPGCGVDLAGTCSHARSVIYYAEAITENSFGAIQCQDYQAALDNE
CGSSFSSVRMAEDTNAYNVEGHFYVPVNSEAPFGQTE
drom