Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Mbeg1-like

Mbeg1-like


Genes:Proteins in Mbeg1-like (131)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9actn-a4e7n0: Collinsella aerofaciens ATCC 25986 Putative uncharacterized proteinCollinsella aerofaciens ATCC 25986 Show
MSDSPNFLTYAQTAFDPFEERPFCAVDSLVFAWLSYLRLPGDMAELTNWQ
GLDVRELLRAECYQDMIGDLWDPEGSRALLEAVAASPRYRGVRVCGYRSV
SDAETTEQFAAMTFRFPAGFSYLAFRGTDSTIVGWKEDFNMAFRCPVPAQ
ESAARYVDEAADAIDGPLLCGGHSKGGNLAVYGAAMCPDVARERIERAYS
HDGPGFVEEFLSGNAFADLSGRIDKTLPRSSIFGMMFETQEDYAIVESTE
FSLLQHNPFSWVVDGRDFVYCERLSAGARYVDGSIREMLLAVSPNERERF
VDALFSVLEATGAERFADIAGNLRESLPVMLQAAQGFDKDTRRFVSQTIV
AILKCALLPKRPQIDMPAAGKSLAEQLEAWQSELLR
9actn-b6gbh9: Collinsella stercoris DSM 13279 Putative uncharacterized proteinCollinsella stercoris DSM 13279 Show
MVEEKVARVLKARESRDTRETGNFLAYARERMESFSERPLCSIDSLVFSW
LAYTHLTTAHDRACTVRGIALHELLRAEDFDEMFGSTWDAQGSRDLLFAV
CASPRFRCARLTDFRFKTDKVSEEQFAAMTFRLPDGTSYVAFRGTDSTVV
GWKEDFNMTFLSPVPAQEEAAAYLEEVAATTSGPLYVGGHSKGGNLAVYA
VAMCSEQVRSRVRRVFSHDGPGFHRAFCAGEPYRRVMPIMEKTVPKSTMI
GAVLSESPDFAPVIVESEGFSLFQHNPFLWEVDVRSATFVAADGFTASSR
FFDSTLDAWMDKYSLAERGRFVDALFDVIGVTGASRFSDIMADIKTNAPL
MLEAIDGLDPDLQQFVKDVIRSFARTATVEKVGGAASGLIDTIKSARPLL
GSGAPGAEDEG
9actn-b9ck47: Atopobium rimae ATCC 49626 Putative uncharacterized proteinAtopobium rimae ATCC 49626 Show
MANIVDYLKWRGDILLDNCPFNDVDNLVLSLLSYLGFDGIVPSERSNKTV
LLSDACQKMIERIKKDPSLISGLSRIDTTFLEALIDSPRFAKARLGKYVN
RLDHNKNMQFAGLTIYLPNGSRFISYRGTDGTLVGWRENLDLSFKITAAD
KRAAQYLEARIREYLRDTQTSAGTHILVGGHSKGGNLASYAATVLPQELL
PYIDRVWSNDGPNMCPGVLDSTAHDILGEKYIRILPQFSVVGMIFNDPQT
PFTIVKSSESGMMAHDGISWQVERDHFITCNDFTPECKKVNEAFSSWYTD
LPLEKREAMTNELFDALEAGGAVYFNEITTSASSLRAVLAALMNTDRRTW
SIFADLFGALVSASASTIREQMNPRQLFSPTTDTYKGGPS
9actn-c4f994: Collinsella intestinalis DSM 13280 Putative uncharacterized proteinCollinsella intestinalis DSM 13280 Show
MDEKGRLPLKAKPAGNFLEYVRERMDTFDERPLCAVDSLVFSWLSYVHIG
PELTRACTVRGIALHELLRAEDFEGMFGSSWDEQGSRDLLFAVCASPRFR
TCRLCDLRFRTDKVGEEQFAAMTFRLPDGTSYIAFRGTDSTVVGWKEDFN
MTYLSPVPAQEEAAAYLDEVAARTPGELYVGGHSKGGNLAVYAAAMCMPQ
HRARIKRVFSHDGPGFHREFCAGDPYRRIMPIMEKTVPKSTMIGVVLSEA
PDFEPTIVESDGISMFQHNPFLWMVDVGAAEFVRAEGYTASSRFFNATLD
AWMDKYTLDERGRFVDALFDVIGVTGATHFSDIMADRKTNVPLMLKAIEG
LDDDLQQFVKDVIVSFVKTATVERAADAASGIIDSIKTASPAIDAIKKRA
GERGHGEQK
9acto-a7bat0: Actinomyces odontolyticus ATCC 17982 Putative uncharacterized proteinActinomyces odontolyticus ATCC 17982 Show
MTTVIKHARDARTPLRADLSPADALVLSCLVYVDFHALPGPRSPHGCLLR
EVAQASSIPSLYRYSLASHADRPLLESAGASARFGGLRVRDAVTRLTSRP
LAQFGAVTFVDEAGATYVVLRGTDASAVGWAEDARFGLDFPTDSQLWAAN
YLAFAAARADGPLTVVGHSKGANLALYAAAATTPPALARVYAFDPVGFPA
PVVDGGFFASIDGLMHIYVTAGSWVSPLLPLPAPATVVASRWPGPLSHNP
YAWCPEGPLLAPDHRRQSRSGVILRNILASVLRARPTRIGTN
9bace-b7ar17: Bacteroides pectinophilus ATCC 43243 Putative uncharacterized proteinBacteroides pectinophilus ATCC 43243 Show
MIWIHSQCTDSNGTIVYSAQNGGFMANMLDYIDWRGDITIHQSGINDVDC
LIMAQISYMNFDGVVGNEPAASFGEAVVTLSEASQRLFELRDSATKGLLL
SDNDTLLLKKLASSRRFGSMKLAAYRAVADEEEEKQFGAVCIFPGDATVY
ISYRGTDDTIVGWKEDLNMSFQTPVPSQVEALKYLNTVAGTFEGRIRIGG
HSKGGNLAIYAASYADKQVQERIRGVYCFDGPGFMNHVLDESNFKNIASQ
IHSYVPQSSVVGMLLGHPVGYTVVESTQLGIYQHDTYSWQVLGRYFVCLD
NVNESSIFMDATLKEWIYSMNSEQRREFVDAMYAIVQQTEAKTLLELSVN
GLKSAKLILKSMKNMDPSTKKMIQRTISALMKIAGRNIKYNHNM
9bacl-a0a2n6sev5: Gemella sanguinis NF-kappaB-Inducing Bioactive Effector, 1 reference(s)Gemella sanguinis Show
MAYSDETNMNIAKEEYKNREPGYILNTEDNEYLGTLSDVNDDRTNNGEQI
YTYTRTEGSDEIVSPDAPLSEREKVEEITILYRGSTAPGIGADNEDARKD
WLNNDVPMAEKIMLGEKGATGQLEASSDYLKEMMEKYPNAKINIYGHSLG
SMDAQYALANVTDYSRIKSANIYNGPNIYSTLTEEQKINVSALYDKINNY
VDSRDLVGLGYKKGEGTVGKTYNFSGESNGINKIDQHMWGGYRFDSDGNL
IDEDGKRVKAWNKPDEIKKLQAEAKNKVRDAAINKVQGLSVDVDHDGKLD
AQFGRDKLLTTELMPGSGAGKDIVINFSSLQGLSKNLQGLLEDIKQIREL
LTKSTTTNSTVESRKANRTETLEQSIVSYLEQINLIKSIKNLDDFYTKLE
GKEKLF
9bacl-b7dps0: Alicyclobacillus acidocaldarius LAA1 Putative uncharacterized proteinAlicyclobacillus acidocaldarius LAA1 Show
MRSPSFWKRLFAFTAASAMLVVPFRFLTVNAIVRVPISKPSASVSSVSDV
TNGIYDGVLMKMTDLSYVNLTGEVGQSFDKMEQEALVHHGPKSLLEEIER
VNGMDWHETYAQAVNEFFSDLRGWRVLAVDNEEAEAGFYAVAYQKGADVV
ISYRGTTNNVMDLVADAGIYLSVPNMIDQLAPAKSFFELACTRASQTVNE
SPIHVVLTGHSMGGWLAQSVYLEERKVSGPWAISGVVVFNSIGTGFQPMA
DPSVSVKDYHFDGDVFSRYGTSLGSVIDVPNPNPDASVYDKHQMYEFYHY
FYPYADGTGPAPLAGERA
9bact-b0fb14: uncultured bacterium pFosPlaG Phospholipase A1uncultured bacterium pFosPlaG Show
MNTTLEKPMKINLIVLISLFIASSAFAGFDWGGASCSGSGTFQQAIARND
VVVVGDIPVGKQEVLIELRSDQDVDIQLFDKNTGLKIVQWPDGILNGPSK
GTTLHGGFVIEYSGYNGDGTGSGHEYIKIYGTVDEPLTMKAFGYAAGTAT
VEYSWEGTENCTEGPARSGSGTFQQDITQNAVVEVGELPAGLTNVNIDLI
SDRDVDIQLFDKNNGTKIVQWPNGILNGAGKVTTTYGSVTIEYSGYNGDG
TGSGHEYIRIMGKLDRPLIMKAFGYASGYATINYSWGLNQSDYEKAIDYG
KLSAQAYDWDDYAAAHVGMGFFANIDDIKATDFATPNYVEVQSVGGYIDW
WGTDGLDFKVFQNTETDDLVVAYKGTEPLSPVDWVADAEQIFGNSEQYQK
AVDFARDLSAQVEQYNVQNGLTGDAAMQLSFTGHSLGGGLATASALATGR
EAMAFDAAGLSQGTINNLGLDIRHASKITNFNVKGDWLSDHNKQMDDTTL
GSELAGIVPETKQYGNTYWLEGINDIADFGGWLVPDNNMAVDFAKSILNH
AWHVYVYMLENDKFL
9bifi-b1s7a0: Bifidobacterium dentium, Putative uncharacterized proteinBifidobacterium dentium ATCC 27678 Show
MGNIIDYARTETRSFETLPFRAADALVLAQLSYDDVPECVPTLDELYARY
STFARRVQSFSFRRPIASLRTLRFAPFHGVTIAHADDELHHDRAVPDHDV
ESVGLIDPQITHDFYRAVAANPRFADVEMSAFCEQFDGDEQTQFAAVTYR
LPNNTLVVTFRGTDDSLVGWKEDFNMAFRYPVPAQVSAADYLGKVAQLWR
GPIILTGHSKGGNLAVYAAMNAEDKVKDRIEHIYSLDGPGFPEAVVRSFE
YASVHERITKIVPDSSVVGMVLETPERCMVVKSDVDGIMQHFAFSWQMHG
GEFAKVEDVANSSVTFNKSLNGWLSGLSEEQREHAVDALFSVLAASGADN
ISGMVAAGPKVIPDMLGTYVGLSGEDRRNINQALMILLQAALSRNPKVQR
K
9bifi-b1s7a2: Bifidobacterium dentium, Putative uncharacterized proteinBifidobacterium dentium ATCC 27678 Show
MGNVVDYVRSEFRTFGELEFSNVDSLVLSELSYMCLSGLVPAFEAAKSVA
TVPIARLLRAEDYPAMFASNSGDMNDYRLALLRAVCESPRFRGLRVGEYA
ERLDTCREQQFAAMTFDLGDCPHAVASPDSDDSADSSAGAAGLLYVAFRG
TDGTLVGWKEDFNMAVRCPVPSQESAYRYVDSIMERSAGFLSVSSAPDIM
IGGHSKGGNMAAYAAMLVAQHDIEESCEQARNLGLMPALGGTVAGRNGRI
PRIYSHDGPGLPQAMVDGQAYRAISGRIDKTVPESSIVGMLLQTSAHYTV
VKADAIGIMQHLGASWQVADGAFERASGLSGGAQVVKKTIDTWLDTVGRE
RRGRAIDQLYEIFAAAGYANIADLTANWTDSLPKILAAAKGTDRETRALI
RDVLKAVPASAAKALDPR
9bifi-b6xwn9: Bifidobacterium catenulatum DSM 16992 Putative uncharacterized proteinBifidobacterium catenulatum DSM 16992 Show
MGNIIDYARTETRSFEALPFREADALVLAQLSYDEVPECVLLLDDLVAKY
GTLQARAKQFDIRRPIASLRMLRKPPFGGVTIARADDELNHDKPVADHDV
ENVGLVDPQVTHDFYHAVAANPRFSDVEMSAYCEQFDGGAQTQFAAVTFR
LPSGTLVVAFRGTDDSLVGWKEDFNMAFQYPVPAQVSAAEYLKKVASLWD
GPILLTGHSKGGNLAVYAAMNAEDEIKDRIERIYSLDGPGFPEEVVKSFE
YASVSDRIVKIVPDSSVVGMVFETPERCVVVKSDVDGIMQHFAFSWQMHG
GEFAKAEDVADSSVVFNKSLNGWLTGLSKEQREHAVDALFSVLEASGAGS
ISAIVAAGPKVIPEMLGTYVGLSSADRHNINQALVILLQAALARNPKVQR
K
9bifi-c0bqy6: Bifidobacterium pseudocatenulatum DSM 20438 Putative uncharacterized proteinBifidobacterium pseudocatenulatum DSM 20438 Show
MGNIIDYARTETRSFEALPFREADALVLAQLSYDEVPECVLRLDDLVAKY
GTLQARAKQFDIRRPIASLRMLRKPPFGGVTIARADDELNHDKPVADHDV
ENVGLVDPQVTHDFYHAVAANPRFSDVEMSAYCEQFDGGAQTQFAAVTFR
LPSGTLVVAFRGTDDSLVGWKEDFNMAFQYPVPAQVSAAEYLKKVASLWD
GPILLTGHSKGGNLAVYAAMNAEDEIKDRVERIYSLDGPGFPEEVVKSFE
YASVSDRIVKIVPDSSVVGMVFETPERCVVVKSDVDGIMQHFAFSWQMHG
GEFAKAEDVADSSVVFNKSLNGWLAGLSKEQREHAVDALFSVLEASGAGS
ISAIVAAGPKVIPEMLGTYVGLSSADRRNINQALVILLQAALARNPKVQR
K
9bifi-c0bqy7: Bifidobacterium pseudocatenulatum DSM 20438 DSM 16992 Putative uncharacterized proteinBifidobacterium pseudocatenulatum DSM 20438 Show
MGNVVDYVRREFRGFGELAFSNVDSLVLSELSYMRLPGLVPAFGEAKSVA
TVPIRDLLRAESYDEMFVSNSSEMNDYRLSLLRAVCESPRFRGLRVGEYD
ERLDEGEQQQFAAMTFDLGADFGLYVAFRGTDGTLVGWKEDFNMAVRCPV
PSQESAYRYADSILDRTERFLSAKKSPDIMIGGHSKGGNMAVYAAMQITQ
SDIEATDERAQRLGLLPALGGSVPGRNCRISRIFSHDGPGMSQVMVHSRA
YQAIAARIDKTVPESSIIGMLLQSQIKPTFVKADAISILQHMGSSWQVTQ
SGEFEQASELTGGAQLIGKTIDGWFDRVSQEQRERAINQIYDIFAAAGYG
NIADLVAHWTDSLPKIVAAARGTDVQTRELIKDVFKAIPASAAKVAVGEL
RNDKEGDA
9bifi-c4feq0: Bifidobacterium angulatum DSM 20098 Putative uncharacterized proteinBifidobacterium angulatum DSM 20098 Show
MGMGNMVDYVRTEMRTFAHKPFGAVDSLVLSELAYIRMPAAVPLFGSARS
IATVPIWKLLQAEHYPEMFCTGSQYDASRHDLLVAVAESPRFRGLRVGEY
AERFDEHTETQFAAVTFDLTDCDGIQPDADSARTMLYVAFRGTDNSLVGW
KEDFNMSVRCPVPSQSQAVEYYRSVDERASNPFAAHPVRIAVGGHSKGGN
LAVYTAMKTQSDHISRIFSHDGPGFMREVTRSHAFHAIEPRVEKTVPESS
VIGMLMSTVSRYTIVETNVSGIMQHMGLNWRIENGEFVTKPELTPASRLL
DRTLDAWMEQFTDQERACAVDQCYDIIASAGYPSFAELADHMGEALPTIA
QAARKTDEATKTLILNILKAFPITAAKSLFEEWPAADGKENETV
9bifi-c4fgw1: Bifidobacterium angulatum DSM 20098 Putative uncharacterized proteinBifidobacterium angulatum DSM 20098 Show
MAAVGNIIDYAREEQRSFEELPFNEVDALILAQLAYEDIPRLVPALDDER
NMYGTFRGRIRHFPMDRHNLRQSAKALLRAPFSAITLKQMDEVLHGGADS
ACQHQVHAVNFTDPAIMHSFVRTVAANPRFSGLHVGAFAERFDTDEQTQT
AALTFLLPDGTLVLSFRGTDDSLVGWKEDFNMAFQYPVPAQRMAADYICT
VAKLWPGDMILTGHSKGGNSAVYAAMNAPAKIRKRIAAVYSLDGPGFPEH
VVTSEPYLSTVSKVHKIVPDSSIIGMVLETPEPCVVVKADCEGLMQHFAF
AWQVDGDAFVRVDDIAPSSHEFNSSFNRWMTGLSREEREHAVDALFQVIH
ASGATTFSGLIASMPLSLPSMIGAIVGLTPDERKHLMEAMRMLAAAATAR
NRNITR
9burk-b5wmp6: Burkholderia sp. H160 Putative uncharacterized proteinBurkholderia sp. H160 Show
MSLSVFEMHSVELFCQRPPGACYVICDEWHYKACLGKAADPQKATAETRE
FLEIAALNHREWEEDRKLVRRIQKSGWLFFHSARHRNPDTDGWWVIVALL
EEVRRGKLLAIRGPRNGLFPSPYRSTPLRNPVARTGSHPDGEPILSVEYD
PATWQAQLAAARAARATSPHIEIPQALNKAQRWQTRKALIAAGNAAMSGR
VRAAAERLARNNVAVEKARLSDHVYEPSGPVPEGWANRSGDSGFLRQYGL
KPIDLEIEGANFRAQLYEPDAAVFGADLNPTLAFKGTEMTSLSDWSNNFD
QSVDMQSPYYKRAVNIGKNLAFSTEPIDITGHSLGGGLCSAASLASGKDC
WSFNAAGLHPKTVEHYGGQVTPSNINAYHVNGDILTVVQTWTPLPSAAGT
PYPLHGSGSPLSRHFITQAIDGIEQQKAEDITVLETLS
9clot-a7vep4: Clostridium sp. L2-50 Putative uncharacterized proteinClostridium sp. L2-50 Show
MANILDYLEWRGDLPFEASAFNEVDAVVFSRFSYIPFEGIVPDDFSHTVT
VAEAAERFLGDTERMTQVIYEDDLKLLAAMGASRRFGDLLLCGYENQLDE
EIQKQFSAVTVKLFDDVSCVVYRGTDKTVVGWREDCNMAFLSPVPSQRAA
VEYLRQAAEQIPGTFLLCGHSKGGNLAIYAAATCERTLQDRILKVCSMDG
PGFEPNVLELAGYNRMLSRMITYIPQNSVVGMLLEHREKYVVIRSMQEGL
MQHDVYSWEVLGPSLIHEDGITDECRVLNASLKEWIDNMDYDQRRQFVNS
LFDLLDECDAKTTDDLQNNWYKDIGRILTSIKKMDEASRKVVSQTILSLL
KITKKNVTNKEN
9clot-b6fnm2: Clostridium nexile DSM 1787 Putative uncharacterized proteinClostridium nexile DSM 1787 Show
MRPTTDKDALVASQIAYMNIEEKDIRDAKKEYGSATLENIFKVSNDNIEK
QYINRVYGNKDPKTTKLSEYEQMRFEEAKAFIEEIKNSEYAQWEIVEVKD
DNANSGFYGCMIDCGEGQSIFGFRGSESDTTHQLRQDWINADIALFNNIL
TEQQKAAQNFVKDMNKKYGDNYTTFDFSGHSLGGNLSQHAGITVPANMQN
KVGTIYNLDGPGYSDEYLLSHALEIDNMASHVKHYQWSFIGNLLNQMPDE
MFQSIRTDDRVYEIYDLEKLTDGALFQKHDTGFVWRWMMEHDTEFFQNGK
MDDFAKTVGVVIRKIENEAPGVVRNLAVDGIFLINLFLLAKESENTKEFG
KKVCKYFIDTFQNGVHIGMEIWDSIERGISKWAAAGVDFIALFKNPYFRQ
VNDFKKKAGRITSTYGHLDMESKLISLNNMTETYQNLDHLMKMYKTFLIA
SADSYREAGKLMLLKEKDIL
9entr-a9x3m0: Serratia sp. XJF1 Phospholipase A, 1 reference(s)Serratia sp. XJF1 Show
MSLPLSFISTMTPITAASASSLPLQDAIKPVQTDEPQVTKVAVPLPSENS
RNAQNLLNSLTRDLSAAVPLAPRLEMSRGQESQQGDYSLALLAKDVYNLT
GQGAEGFSRMSDNDLLSVGIDPASLLDAASGLQAGIYSNKQHYVLAFAGT
NDMRDWLSNVRQATGYDDVQYNHAVAIAKNAKAAFGDGLVITGHSLGGGL
AATAALATGSLAVTFNAAGVSDHTLNRFGINPAAAKQDAESGGIRRYSEQ
YDMLTGTQESTSLLPDAIGHKITIANNETLSGTDAWRPSKYLDRSMTAHG
IDKVISSMAEQKPWEIKANA
9entr-b6xeg3: Providencia alcalifaciens DSM 30120 Putative uncharacterized proteinProvidencia alcalifaciens DSM 30120 Show
MPLSTLIQQTVSKDELSFVEEGLNLYQQNTFLESLCSPRDKWSKNIMRED
FLGRDAQNKDYLLALLSQGAYHHNWRDIHGIEKLSTSKINALGIDAELLN
NEFTGFQSNICCFNGLYIICFAGTNDIVDFYANIRQGLGYYEPQFFQAVG
LTNILYRAVKGNIICTGHSLGGGLASIAALASQSPCISFSPSGLAQNTVH
KIGMDYNIAKQRADEGLIRFYTVQYDWLDVLQNRLPIPSALGNCIKMAYS
EHNSWKDWLPHRLLTRSFIAHSMVKIIRMMCKHKPWNNWNAITGEFDKTS
DSMLNDLPNIEQRRSSNWQESCKTSIKRENINEFIALLSMKNKHCDIDKL
AMQSVRAGNSQFIKILLESPYGQGIKKMQLAQQKTVLHLAAQSGRVAQSE
ILLSNGLMVNVKDNLGNTPLHDALNSHSLEVAELLLSSGADWRMENSQGY
NCRDILDNHMIKAESLTHESRIMREKVYKLMN
9entr-PLAA: Serratia sp. MK1 phospholipase a1, 1 reference(s)Serratia sp. MK1 Show
MSMSLSFTSAIAPAAIQPPMVRTQPEPLSSSQPVEASATKAPVATLSQNS
LNAQSLLNTLVSEISAAAPAAANQGVTRGQQPQKGDYTLALLAKDVYSTG
SQGVEGFNRLSADALLGAGIDPASLQDAASGFQAGIYTDNQQYVLAFAGT
NDMRDWLSNVRQATGYDDVQYNQAVSLAKSAKAAFGDALVIAGHSLGGGL
AATAALATGTVAVTFNAAGVSDYTLNRMGIDPAAAKQDAQAGGIRRYSEQ
YDMLTGTQESTSLIPDAIGHKITLANNDTLSGIDDWRPSKHLDRSLTAHG
IDKVISSMAEQKPWEAMANA
9entr-q54889: Serratia proteamaculans Lipase, 1 reference(s)Serratia proteamaculans Show
MSARAPVAANQGVTRGQQSQQGDYTLALLAKDVYSTGSQGVGGFTRLNDS
ALLGAGIDPASLHDSASGFQAGIYSDNQQYVLAFAGTNDMRDWLSNVRQA
TGYDDVQYNQAVAVAKSAKAAFGEALVIAGHSLGGGLAATAALATGTVAV
TFRRRRFRLHAEPYGDRSGGEERCPSGGIRRYSEQYDMLTGTQESTSLIP
DAIGHKITLANNDTLSGIDDWRPSKHVDRSLTAHGIDKVISSMAEQKPWE
TRANA
9firm-a5zpa7: Ruminococcus obeum ATCC 29174 Putative uncharacterized proteinRuminococcus obeum ATCC 29174 Show
MGNIMDYISWRGDLSFEQSQFNEVDNLILACFSYVNLDGISAVTKQKGIG
LKKLTKEFMKLHTMKELEADKSFIRLAPFMMMEMAKSVRFGKCVVRNYVN
DIVTEAEQQFAAMEIVLEDGTSYVSFRGTDDTIIGWKEDFNLSTGVVPAQ
KRAIEYLQKISEHTDGMLRVGGHSKGGNLAIYGSVMCKSAHEKILEIYSN
DGPGFSREFQELPETKEMMPKIIRIIPEYSIIGTLLEHEKEPVIVASSSK
GLLQHDAFSWEVQGPALVRRDSLNKTALRFIEILHKWIDGMDMEQKRLLI
EDLFATLQASGYENLSEVQSGGLKSLAAMVKRVEKFAPESRGMMQELLTA
ICGGWLEQLQADTKDKLSVLPLSFSDKILEKF
9firm-a8rb13: Eubacterium dolichum DSM 3991 Putative uncharacterized proteinEubacterium dolichum DSM 3991 Show
MEKETLFCSLSLLSYFDYDTTDVSVEVMLEEIVNDQQLRLDYAAMPEFEG
NIKMLEELNGSDYRDIRVKLCRNDNANSGVVFYVFADALYDYYVFRGSEG
LDSVNHRTGWQDWADNVRMFRDEPTLQQLIALHEFYKIEKKRPFYLAGHS
KGGNLALFIALAMREDLMDLLAGVYTYNAPGITKSMMKLYAQRANDASFQ
ALLHIYENENDTVSSFFEHLVPPCYYQSSLSCTNFTQLYHNHNLYAIRFE
NGRLVPTANKSAVPRLVHIFLYNFFAGLKKEKLEKILAVCDDYFNSNLSM
QELYKVMIYHISNYISLFDDISYDEIKTITFQDLIERRKTRHLSEKLAED
IGRLHIQELTQRFVDGYEAMMKGKAGELQQFIRENNQKIIQMIQSIHQGK
EEQAEANEDTLA
9firm-a8sie6: Parvimonas micra ATCC 33270 Putative uncharacterized proteinParvimonas micra ATCC 33270 Show
MNIEKRTEKRGFQKTIIEKNVISIDIFLILNCIIYVHNFERDDVQEKLVG
KNIFEIFDFIRNEKNSSGYYPAEINEDEFLGILNTVDHSRQVYEKIKIVD
IDNSVYGNATGSDRVVNVSFLFEDCLIIVYKGTAGDYEWKDNVEGTYNIT
DTKQQRRALRYFDKMVKKFDNIGKIYVSGHSKGGNKAQYVGVLRGDMSKL
KNVYSFDGQGFNINFLKKYNKEIENNKYKIFNICNEYDYVNIIMHSVSNK
IFIKSVINIGNEDNRYSKIIHRLGGVHSPYSMFKKENGILTLNDVVEQSE
IMKNLEKLFEYYNANMKEEDNQFMYYRMSLLMMKSGKEVFGEECPIAPKG
FSRRFIKLTRDFTKNESGLDSSEIINLFKPILSDIGSIIIKGKISENSR
9firm-b0mef0: Anaerostipes caccae DSM 14662 Putative uncharacterized proteinAnaerostipes caccae DSM 14662 Show
MKIEGYCLSTQRSSPMSTNIFDYLAWRGDLSFQECRINEVDSLILSCLSY
IRFPGIVPGISESGSVTIKEASDAFFSQDRENRRTRTKEDERLLRMLGES
RRFGPLRLSRYADRLSREQEKQFSAVTILFEDHSAFFAFRGADSTLVGWK
EDFNMAFMPVIPAQKEALEYLIRGAEQTGGPLLCGGHSKGGNLAVFATSA
CPKAMQRRIQTVYNHDGPGFEKEMLKSEGYLSVSDRIHTFLPQSSVVGML
LDHEDDYTVIHSTQTGLLQHDPYSWEVMGPEFIRVKSVSTSSEFIDRTLK
NWLSGLSSSERKDFFNSLYQIFSATDAETLQDLPVCWIKNFRKVSKRLLD
VSPENRRMLHRTFFRLLDAGKEALLKEL
9firm-b0n5t8: Clostridium ramosum DSM 1402 Putative uncharacterized proteinClostridium ramosum DSM 1402 Show
MSNIYDYLKWRGDLSMRIDPFNDIDGLILSELVYVDFDKIVPTFPNEQSY
CLKDVANNFSQVNNIEELLDEISFTKESITLLQELAKCPRYQNILLSNYI
NELDYQSIKQFAAITFQLEDSSIYVAFRGTDDTILGWREDFQMTYQFPVA
SQQRAVEYLAKIAEIDFSKSLFYLLCHCDYKMKWYQIFRIYITQKISGVK
IRVGGHSKGGNLAVYASSCVNSKISKRIIEIYNNDGPGFNQKMLNTDNYR
NISTRIKKFIPESSVFGIMLENLEEKIVVKSSAKGLMQHSGFSWSVEGTQ
FVCATEMSKDSQTMDAAFKSWLSKVDSKTRKDAVTAVFSILEAAKIEKIN
DFSEKSLSHLITAIKEIKNMNSDTRNALIQFFKTLIVETYDCSRKEHKKK
DTNENNS
9firm-b1c295: Clostridium spiroforme DSM 1552 Putative uncharacterized proteinClostridium spiroforme DSM 1552 Show
MTNIIDYVKWRGDLSFQNDPFNDIDALALSLLVYVEFNNVVISEKCYLKD
VADQFFKLNDVEKLMQEFSFTKNSIILLEIMAKSNRYKDILLSDYVSELD
YKITKQFAAITFWLSDGSIFISYRGTDDTILGWKEDFMMSYKTLIPSQIR
AKEYLEMIIGKKYKYSLSFLIKNRDKQTSAFKILKEYLYQYFYGVKIRIG
GHSKGGNLAVYAASNSYKKLINRIICIYNHDGPGFDLQNTKLINYDLLIS
KIKKYAPENCIFGIMLDSLEDVVIVKSDAKGLMQHDAFSWQIEGKNFITC
RDFNKDSQAMDITFKSWLSKVDKDTRKQAIESIFNILDAIKIEKVNDFSQ
KAFIHLIKALKQLKNMDSESREAIICFFKTLLIENNNSRKEYKKK
9firm-b7c8m3: Eubacterium biforme DSM 3989 Putative uncharacterized proteinEubacterium biforme DSM 3989 Show
MDEHISLNVFMHYNKPMKNIIDYIKEYGNLTLEEYPFNNVDSLILSQISY
IKFENSSIDIESEIHLLSDFENEINDLCTNTRVPELNEELFLQTIHSLRY
EAITISHLQTNFDKDNEKQFCAMTYHLPNQTDYIAFRGTDASFVGWKEDF
NLCFQENIPSQISALNYVNNYKTNHKLILGGHSKGANLALYAGIHTHNPI
YCIYNHDGPGFLTPYQTDKKVFKTIPQSSVIGLLLEETNNYQIIQSDAIS
ILQHDPFTWCVENGDFIYLKQNDQLSKHTQSTLSKWLKSIDINTRKQVID
TIYSIFSDYENPKDLRKNIDIAEMIKSIQNMDSQTKKMISETIQVLFKCI
QNEIKRGF
9firm-b7cbt4: Eubacterium biforme DSM 3989 Putative uncharacterized proteinEubacterium biforme DSM 3989 Show
MENLLNYVHLRRDIDFSIRPFNEVDMLVCADLSYVDWDGIVEKDEVSLEE
ACRKYLSLYSEEELKSKYTFSMNLPHLIDALQDTIRYGNIKLKNYKKVYS
DEDVIQFSVVTLVLPDGSFVISFSGTDGSITGWKENLMMTYSKDLPCQIL
AKDYVKKTIADIPETSYLFGLKKKKVYPKMYLTGHSKGGNLAMYAYLKNP
KLQGYIESVKSFDGPGFADGFWQGDEDVSKITNYIPKDSIVGRVLDHREQ
TKVMDAQGSGLVQHDTLMWSVDVKDFNYCDALTKESDDLLEYVNKLLMDR
PLEEKERYCHLIGELFDRMEIYTIADLTEFSFKQALSGIKEIRQLNAEEI
KFMFEVVKFIAVQSAPILVKGRK
9firm-c0frk4: Roseburia inulinivorans DSM 16841 Putative uncharacterized proteinRoseburia inulinivorans DSM 16841 Show
MDYLDWRGDLTFREAPFNEVDNLILAQLVYVEFAGIVPAPGEEGTITVKE
ACELFFAAHDRKEIMERVSMTKTAAFVLEKMAQTERFCNAQLFGYINDIS
KEEQSQFSVVCVRLDDKSIYVSFSGTDNTIVGWRENFNMGYLSETPGQLK
AVDYLNHMVKEDWKKIRVGGHSKGGNLSVYASVKCDRNIQKRIVKVYSND
GPGFSEEMIQSKEYQRMLPKIKTILPESSIVGMLLEHQEKFEVVKSSQSG
IQQHDAMSWEVLGSHFVYVEEVAPQSILLDETMKKWIFQLTKEQREEIVD
TVFSMLDDAKIYTVDDFYNSKWKKVQELMKAKSKLSPETQELFSQALRML
WKTGNQTVKKSVKQAVLEKVEEANSLFSTDKSKKSMKSSKK
9firm-c2ky88: Oribacterium sinus F0268 Putative uncharacterized proteinOribacterium sinus F0268 Show
MELLDYLAWRNDVPLSVSPFNEVDNVIFSYLSYIEFGKLLEKGDGFFDLK
EQYEHFCEKHSMEEIKTAGQFTERAPLLLQKMMEGPRFQDTKVGYYVKDF
DKDTVKQFAALCVLLPDGTNYVSFRGTDETITGWREDFLMSCQSETAGSK
EAVSYFNKVAKALEGKFILGGHSKGGNFAMYAAAFCEPEHKERIMQVYNN
DGPGFREEVIQSPEFQELLPKIITIAPQSSIIGQLLSNPAKQHVIHSTAK
GILQHDAMTWEAEKHCLVSSELDELSEYTKTTLGSWLETMDDETRESLCT
TAFSLIESTKSETFIEFSGNLMKNMETIWKEMGKLPEDKKKEIMNALSKL
IESSKQAAVSQIKSGGQTVISQIQSSGQALLSQMQTGSHAAISQVMGKTK
EEGEKV
9firm-c4fwx0: Catonella morbi ATCC 51271 Putative uncharacterized proteinCatonella morbi ATCC 51271 Show
MSDFKQYIKNIGHVDFELQPLNEVDIAVMVEMVYLKLDDYVSHVISESKA
ISVMDFYQQFAQDKKEIQEENPFLISKGRLEVAKAAAQASRYRNIQIFGF
QSDLDLKLEKQFAAATFYIPEVNTYLVVFRGTDETIVGWKEDFNMSHQTQ
VPAQDAAREYLTKVMTEFDGQYIIAGHSKGANLAIYAASQLDKKLQNQVS
AIYAYDGPGYQREFLESEGYLGIESKIHAFQPEDAVVSQILFHTVQAKVV
ACKGISMMQHLLENWQIDKVSFKEVESVTPGSQRLQATLGQWVDQHSAQE
LEEFFGAIFGIIEATGIETLNEIGDNFLMFLISLQREIRDTEDSDLLKEG
FAQLQAIYKEQGDETNANFLEVVQGKIDSAANFIKDLVPDALLPGKSEDK
QVEEEGEPQANSEEIEHGAI
9firm-c4gby7: Shuttleworthia satelles DSM 14600 Putative uncharacterized proteinShuttleworthia satelles DSM 14600 Show
MHWQGGNMADLIEYIRWRGDLTFSERPFNDVDNLVLSQIAYHAFDGIIPS
PGQGQISLQEAADLFLEHPERGAIPGQDQSQNNRFLKEAASCPRFGRVLV
SDFVNDISDYCNNRMQFSALCYHLPDDSHYCAFRGTDDTVVGWREDFMFS
YEITNAQKEAAFYLASRVTENPDALWRVGGHSKGGTLAVYAATNLVADLQ
DRIDSVYSNDGPGIPEEFSNREGQARIQKRIHKFTPTYGMIGMLLEDPDT
IRYPAKAQEEGSLTIVKSSARDIVQHWALSWQVEGDHFQTALDQQPRVKH
LNRVFDRWIRSASFEERQAFIRTLFDSMNEVGSNVSDLLKSPIQVGNIVL
GHMRDADSLTQSAIRKFFDSLGHENQRQLLEGLQQTQKNLLKRLGITGGD
NNLSDQQKSD
9heli-c3xin5: Helicobacter bilis ATCC 43879 LipaseHelicobacter bilis ATCC 43879 Show
MGKNRELIKKFRDYADIADASYAMLHWVFENEENEIYDNLLGMNRWHFAD
NIALSDKTTENDRYLLNNEKIGANKNTAYARCIEARFMQDVVFKKGTFFD
DKIDNDPKNIPLNATLSLRTITFTNRYELLAHQPNTKYGFSATLFEDKGE
LIDKATNTRKVVLKDSKYILVFRGTEIGADDISIDIVLATNGIPMQCYEV
ARFYEKQVKPKIKNSKLIVVGHSLGGYLAQSFCFMYPERVAELYTYNAPG
LLGAWNKTLAQILRDGAETALMVGGVSAIIKNIAKITITKYVGYSFLISI
GVISLKVKITYEDLIPKELQEYKGIINYLIKNIKDAEDRDGVYMPYPLNK
NNHYHIEATDRLDFKSHMSNTSYYVNLIQHLGTDIAGNYYPIYLGFNGLD
SHFLAPMLKTLYFYSYLLELDSNLTFFESNLDKTIQSLNSVVTSIVKILY
HTDSYNKKRDEAIRTANDNSFDLDPPSNHIYATIDKTLFEATLKTTNKDK
FSIDEKTLSNMIDGILYLQDNNIFLKLLSKDNMQQADKNTNLAILLAIHE
NLFFISVDTANNKEAILIKDKDSIVQLLKHNATRTQIFCYNLEHIDDGVI
KGYANEALKYYPQFKEAQ
9laco-c0xd53: Lactobacillus gasseri JV-V03 Putative uncharacterized proteinLactobacillus gasseri JV-V03 Show
MNNMLVYAAKERKSFSEASLNEIDSMIFSQLAYCNFDLLPQITKLTDLVS
DDEIKTLTQGNLGGKNTEKLIKIMIKNPRFKNVSWHQAISKVDAKTQMQF
NAVTFYVATGEYYVAYRGTTATTIGWKENFNMSFRDWVPAHYFARSYYRK
VRNKFPGKFYIGGHSKGGNLAFAVALGLKEVDLANIVRIDCFDGPGFHNQ
DRLKNKFLKLKGKIHKYIPQGSLIGILQDDLIGEKDYCTIVAAAGVNILQ
HDMFNWRVKNGKFVTLKQLDSTSEISWKAIAEWLKNTTDAERRDFIEMLY
LTVSDTNQIYFRNLLTPKTTYKLATRLIKNSSVKKEVWEPIIRKLFQAYV
NSGTTTLSEQRRNNLMSFKNILDEQRR
9laco-c0xef2: Lactobacillus gasseri JV-V03 (strain ATCC 33323 / DSM 20243) 202-4 Putative uncharacterized protein, 1 reference(s)Lactobacillus gasseri JV-V03 Show
MGKILDYVRWRGDLTLDREPFNSLDAGLFAAFAYLPFDSSVKGHTLEAAT
KRLIQKKTLIHSDKLEAELVNLSDRYKNMHFLDWSHLSQKKPPVQFTAMT
IELDSETILVAYRGTDGSMVGLNEDVDMSYQPEIFGQSVAADYLDKMAQA
YPDKKIYTVGHSKGGNFAAYALYAASPSLQDRVIKAYSFDGPGFMKEMYN
QIEFQRVIPKMMTYVPEGSIFGMMLDHPERVIVVKSRMKHLMKQHNPLHW
EVARNSFVMAPGLSNASRIIRSTFISWNTKIPREKREAFWLAFFTALESQ
KITEASQLTTNKIRGAIQFSHAYLALDPDARLIANEIISDITATARQYIN
LPFLSHNEHLEPLGNDSSKGPIVDDSYDGS
9laco-c2elr4: Lactobacillus ultunensis DSM 16047 Putative uncharacterized proteinLactobacillus ultunensis DSM 16047 Show
MRVNEQLTDREQIELTKKAYEELQLGDSVMVGQHHIGTVCRSVWAEDGMR
AFVITNPSEVTILYKGSYGIKKGTPQTWRDEWFKTNLPILRSMLSHERRI
PSQLRSASRLLNQTISQFRGSQIYIYGHSLGSINAQFALANCRHPEAIGA
AYLYEGTNIWLLFTPKERRRVAQMREKIYNYVDIYDPVTLGITETHHMVG
KLCYVDSEPMKPIKQHMWGGYSFNPDGSLKLRKVDQAFLAESRSERRLLD
KSGDLTEFIERISSSDEVKKMAVEKIDQLAQRYPDHKSLAKLATLFKVEI
LKERDELK
9laco-c2eml8: Lactobacillus ultunensis DSM 16047 Putative uncharacterized proteinLactobacillus ultunensis DSM 16047 Show
MYPDNNILTYLKWRGDIDFSTSPFNDIDALVLSIFSYLELPDIVDSGSKT
ITLEKAAKLYFADDHPRNDNLQYQELFKLMAKADRFKDARLSYFVSTLTE
HTQFSAIKVELTDGTNFIAFRGTDDSLIGWKEDFEISFRITTAQRQAVKL
LEKILKADDEDYYLGGHSKGGNLAEYAAINIEPKLRKRIKRIYTFDSPGI
AEEVGAQLPAKYLKNTLRRFVPEFSVIGRLFEPAGISPTIVNSTRKNLSQ
HDAFSWQIVGSNFDTKRHRNPQSQVYNQLINQWIGDATLDERESLTNDLF
SALGAGGATKINELDKNGFSGFGAILFSFADSSRRTRFVFGSLFSAIWQM
IKSRHLTKVLFSTDTIVGWIMVVLGIISLTLPQYAVRAFGALVAFAGIAF
SAHQILDTAKSKLKERQKNFFITSYLVVFALSTALISNNRLLIFLAHYFL
GLFLIIYSYVRLRQLILRKIPGVFHIIIVAIEAIIAFALGIVVVVNPSAF
NRRSIIIIGSLLIAYGFFKLIGELFTQRNKMPKNHR
9laco-c2enu7: Lactobacillus ultunensis DSM 16047 Putative uncharacterized proteinLactobacillus ultunensis DSM 16047 Show
MAGTLDYLRWRGDLSFKEKTFNNVDASLLASIIYLPVDHTAKGHTLSEVA
EKLRKLPSFQVQMQDLAGTQVLLLPPSPRLGNIKVLNWTNRLEKDPYPLQ
FTAATFRLTPDTIIIVYRGTDSSIIGWNEDMNMNYMPKVYGQDVAANYLK
EMAQEYPHDKIYLAGHSKGGNYAEYALSVAEPELQDRIIRALSFDGPGFF
HQVWKSPGFVRAESKMKTYLPESSIIGTMLDHPERVIIVKSTAPMLQQHD
PRRWSVGRDSFVLAESLTSGARSLRHSFIDFNHSIPDKQRGELWDALFQA
FDDLNITDVFQITAHKLIGTVRFSRAIMSLTPETRKYVLHMIGEIINAIR
GNISLPFNETDFALYPKSNDSNKAPIFFEFYDTTVPSILPEEIKQRFKEE
KEKEKREGKEQDKNKGKLQ
9laco-c2esh2: Lactobacillus vaginalis ATCC 49540 Putative uncharacterized proteinLactobacillus vaginalis ATCC 49540 Show
MTHLVSRKQSLTDWQRVQLAQLEYHDWHLGEDVLLPDGQLIGEVIKVIWT
ADGFRATVIRSAAYPQIIVLFRGSSGVRKGDPTTWTNEWLRVNLPIGNAI
INQVPDVPQELWTASKEFNHLLASYPQMTFFLYGHSLGSINAQFALANCH
YPERISAAYLYEGPNLYWLLDAKQRQTTTLLRCQIFNYIDPLDVVALGYI
DMEHTIGLLRVIDSMMTSPINQHMWGGYQFDKQQNLLLENDFWQNRRAQI
CQRLITAVQKLNQNNDEWER
9laco-c2kc76: Lactobacillus crispatus JV-V01 Putative uncharacterized proteinLactobacillus crispatus JV-V01 Show
MYPDNNILTYLKWRGDVDFSTSPFNDIDALVLSIFSYLELPGIVKSNGTT
ISLEKAAKLYFADDHPRYDNLQYQELFKLMAHADRFKNAKLSYFISTLTE
HTQFSAIKIELTDGTNFIAFRGTDDSLIGWKEDFEISFKITVAQQQAVKL
LE