Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: PGAP1

PGAP1


Genes:Proteins in PGAP1 (153)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9bact-c7f9k2: uncultured bacterium Lipase/esterase, 1 reference(s)uncultured bacterium Show
MPNLVFASGVLMPQKIAGLAYFKDLADHYPPQTTLFAPVSSLGSAALRAQ
QLASAIAAKFPAGEIHIVAHSMGGLDARCLLARNLQGLASAGRVVSLSTI
STPHHGSPVADLLLGEPAGLEFPFNHFLDQFASANAHALVDLSTKGAPGF
SEKDPVPGIRYFAYAGKGLGSAQLFPTHVYVKTLQGDNDGLVSVQSATWP
DRLAEPPWDTDHFGEMGYDLNRPDLTTPFPYLDAYARVVERATAQAAAT
9bact-d8v1j0: uncultured bacterium Esterase/lipase clone EM3L7, 1 reference(s)uncultured bacterium Show
MTYPIVLAHGVCRFDALLNDALDLDNNDDPELDNLHYFKGIRTMLKQKGY
IVYHSNVAWAAGVEKRADDLKENLLKILNETRTEKVNIIAHSMGGLDARH
MMFNDRNDEEIHQRIASLTTISTPHEGSPFADWGLDNLTPLHLLIQKLGV
DLSALKDLRTDTCKTFNEHQDVKEFEMACKGTIKFQTYAGRQDFWGVFSG
LKIPFEIIRKAEGENDGMVSVRSATWRDEYFKGTLDKTDHLNEMGWWAPD
QLLAAESPDELLARIHSFYAGIAEQLP
9burk-a6gq58: Limnobacter sp. MED105 Putative lipase transmembrane proteinLimnobacter sp. MED105 Show
MIRHLNRLYWIGYISVMFGLYWLLHHWFGARSDNAAVAAICLVVGVLFSA
HVGFNISGFALSYSVRQIPQVRDKGLHFHSTEGEGFHRLSLARWVKAVLV
ESIASLKLITLLQPWAPNPDGIQLAGKTWRKKKPLPVLLVHGYLCNSAVW
AGTRALLDRAEVSTHAITLEPAIGSIRSYSEAIHEAIDELLVATGAPQVK
IIAHSMGGVAVRYHATEYGHHRIAGMITIGSPHYGTALSTLGIGKNVKQM
AWGSFFLKTLREHPTDREFQQKIWSLWSPQDNIVCPPVSSKLEFGKNTAV
PGCGHVALLNDSTTEDLILNWLAEDAQAYPLAENRA
9burk-c9yb37: Curvibacter putative symbiont of Hydra magnipapillata Putative uncharacterized protein, 1 reference(s)Curvibacter putative symbiont of Hydra magnipapillata Show
MLGALLMPWLAVVLSTSYTMLKSRAPGEPSSMFYRAWWGETVANFRTFVL
RQPWAEPQPAVLPATDGVKRVPVLLVHGYVCNHRLWDDVTLRLRAEGHDV
LAINLEPLFTSIDQYAEHIEVSVQALMKHSGQSQVALVGHSMGGLAIRAW
MRQCGSAHVARILTLGTPHAGTKAAKQNRTPNGRQMLWDSAWLQGLAESE
TPERRALMRIALTPQDNIVFPQRAQTLPGVNPVVFEGLGHVQMCSAPVVI
DWVANELNSPPLAA
9chlb-q4apz8: Chlorobium phaeobacteroides BS1 hypothetical proteinChlorobium phaeobacteroides BS1 Show
MTKSDTHLVEHRNNRSDTAVVFIHGFNGDASSGTWGDFPDYVRNNPAHAN
RDIYSLGYATKLSIDLVGLWEACPDISKLACFLHTCCTNPPLDRYKSLAL
VAHSMGGLVVQRALVDYDDLARVVSHVFLFGTPSGGLAKASLFKMLNRQV
RDMVRNGPFVKDLRYRWVLRFGDAAGKTLPFKFWAVAGDRDEFVPAGSSL
EPFRKHFSQASVCVVLGNHLDIIKPLSSNHLSAQLLFKGLQGTAEISGPW
SGAAVAVESREFVNAIELFEPHQEELDTDAATLLALALESVGRSKDAMAL
LEKYKGSSTDAMGVLAGRLKRRWLVERRAADALRARELYAEAYKIAEQAG
DHAQAFYHGINIAFMDLAYSSTRTEAKANASRMAAKVLLHCKSAKPEKWR
FATEAEALLMQGESAAALGRYKAYIEECPSPRELESTYMQAKKVADLMGL
RNANDQLDSLFLGIG
9firm-q2ahs1: Halothermothrix orenii H 168 hypothetical protein precursorHalothermothrix orenii H 168 Show
MSNMFVLKCLTILLTTGILMILPSPDVLAEKRIDYKSRDSWNDILNHEDT
VNYPVIFIHGIGGKLSFWEKTIKTMVGSNYYEMRYIKNNKVYHNYYGEEP
ERWVWNISYYTLNGVKETIYGDLNLYARRLHKMIEIIKEITGKDKVIIVA
HSMGGLVARKYMTTNNKCWESVYKILTVGTPNEGVEVSVGIVGQLRDLKK
GSSFINNLNRDWVKMKKHHEKWGIVAGIKNNSFLIDYNFNPRATDAAGPG
FVTVSSAIPFGEWEGAFRTGVGKEAYNTPHFGFRILVEASHMDLLYHRGT
FMGIHWALMKNDR
9gamm-q1udv6: Psychrobacter sp. PRwf-1 hypothetical proteinPsychrobacter sp. PRwf-1 Show
MSLYGSGLMINPTSPSSAMPISHQSSALTTNYPLQADNDQLDERAWQDPE
LSLRDFVAGISQLAVMGVIETTGIAEAIHREIVLRPLGLLNHRYGDLWYK
GISGRVYQVVKGITSIVGHSLAMGLKQYSQLMHHTKPHPLPNTLSMVVNV
INGVMGDHLVSNNNPLALPMTLYGVDGHHKYTKPILSKRTGADESLSKLG
NTTQTVYTNQRIKGRVIIILHGLCMGYINWQPDDDASLGRRVIKNLPAST
VLYLNYNTGQRISTNGRQFSQLLEMLITQYPDITQIDLIGHSMGGLVSRS
ALYYGSEQQHNWVNKVQKLITLGSPHHGALLERIGDVVQQSIGKLPFAGS
LAKLGDIRSMGIIDLRHGSVRDEDWQSLQTRSVLPDSERHVTPLPQHIKA
YFLAGSLSEEGQASKVSDLLGDGLVNINSALGEHTTEHTLAVPKERKAVF
YGVGHMSLMFDKQVLDKTVEWLVK
9gamm-q1uec0: Psychrobacter sp. PRwf-1 hypothetical proteinPsychrobacter sp. PRwf-1 Show
MSNSTSPTSPASEDLSQQYSLYETCELINASNPVYLEDLHQQLDHLDYLD
ENALINMAYEPSAPSKKPPLSVSNVLEGLVQLATTGAVGATEIIEAIHSE
ILLRPLGRFNEDHLNRWQQGVTRRLYNVVRYTMQSVGRGVTSSSMQLYRK
SLINQKRRLLPERLKQLVNVINGMVGDHLVARDNPLAVPMVLYDRYGQPL
GAKADPLCGRVIVLCHGLCLSYLSWHPCEEDSLGEHIALSVPKSTVLYLD
YNTGRRISQNGHNLANLLQQLVIKNPDITQIDLVGYSMGGLVSRSALFYG
EQERQDWVAHVGNLVTIGSPHQGAILERISYHLLDIMAKVPFAGSLSKLG
DIRSAGIIDLRHGCIRDEDWKGLKVRDVLPEDFRHPTKLPRHINTFFIAG
SIAEGVYESKASNLVGDGLVMIESALGEAGKTHENHHLYVPEGRKAVFYG
VNHINLQYDERVHNQVSEWLQANRDSESALKPRIHSFPDEIEVVV
9gamm-q1zes3: Psychromonas sp. CNPT3 hypothetical proteinPsychromonas sp. CNPT3 Show
MACNTECGCKPAVIMLVFIPGIMGSRLKNTETGDSIWDPTAGGGFHESSA
MASAKEKRKQELVQMQSLDDDSVFEGLSKWFSRNVDFKVSFAYATEIVPQ
VARKLWRIPRIKDWVFSGPKGRKKLISNEDEKDAYGRQEDLTSVDEGTEA
YFKMYTSVSSQQIAEKTFRGWGSVLWASYGGFLKWLQGCEWDFKADYPGS
SFPVYAVGYNWMLSNRVAGDRIKDKIHGFVAEAVSEGADKNNIKIILITH
SMGGFAARSAVILSGLKDEIELVIHGAMPTDGAPQLYQEFRTGSTGASKL
VLGKNAADTTAVAGFCQGGLELLPNHAYKMKSDSEMKCGKASHEWLYYNN
GVGANKLLPVEYGDKIYDFYRHFDRWYSMVQPALLAPEMKAEELTKDKLD
FYTEEFNKRIDDCKEYHKALAGDYFPTTIVLYSTSDKSHDCSVWQGGNNL
DEQPVESWKTISNENNDWFFGDGTVTLMASDAEIKRARQIKQRQREALVS
HQFMPPMTVAVEKYTLGAKLVDGDGTVNAGAGEGLPIDKVRAIAIEATEE
HQDFYNCPKVRTLVVDQIKAALPDIHDKITRC
9gamm-q1zes8: Psychromonas sp. CNPT3 hypothetical proteinPsychromonas sp. CNPT3 Show
MACNTECGCKPAVIMLVFIPGIMGSRLKNTKTGDSIWDPMAGGGFHESSA
MASVKEKRKQELVQMQSLDDDSVFEGLSKWFSRNVDFKVSFAYATEIVPQ
VARKLWRIPRIKDWVFSGPKGRKKLISNEYKKDAYGRQDDLTSVDEGDED
YFKMYTSVSSQQIAEKTFRGWGSVLWASYGGFLKWLQGCEWDFKADYPGS
SFPVYAVGYNWMLSNRVAGDRIKDKIHGFVAEAVSEGADKNNIKIILITH
SMGGFAARSAVILSGLKDEIELVIHGAMPTDGAPQLYQEFRAGSTGASKL
VLGKNAADTTAVAGFCQGGLELLPNHAYKMKSDSEMKCGKASHEWLYYNN
GVGANKLLPVEYGDKIYDFYRHFDRWYSMVQPALLAPEMKAEELTKDKLG
KYVLEFNKRIEDCKEYHKALAGDYFSTTIVLYSTSDKSHDCSVWHGGNNL
GEQPVESWKTISNENNDWFFGDGTVTLMASDAEIKRARQIKQRQREALVS
HQFMPPMTVAVEKYTLGAKLVDGDGTVNAGAGEGLPIDKVRAIAIEATEE
HQDFYNCPKVRTLVVDQIKAALPDIHDKITRC
9gamm-q1zet3: Psychromonas sp. CNPT3 hypothetical proteinPsychromonas sp. CNPT3 Show
MVCSSECGCKAKITMLVFIPGIMGSRLKNEESSDIVWDPAPGKGWYDSSQ
MASVKARREKELTQLQSVDDGGVFNLLKHAYNIASDAVDYAVVYVAEIPR
KSWRNVSGVVSSMFHYTFLSAKERKAELANDDKEDAFYRKKNFLSVDEGT
DKYFCQKTSVPKSQVEEKRTRGWGTVLWGSYGEYLKSLQNNEQLFQNGCT
GASFPVYAIGYNWMESNQASGEHIKTKIDEFKETLAKENPDGILKSDIEV
ILITHSMGGFVARSAVKLSGIESEIAYVIHGAMPTTGCPKTYQQLRTGDQ
SMAKLVLGINAAEMTAVVGFCQGALELLPNKDYTMADKTTQWLYYNNGEG
ENKPLPVACGKNIYDFYCQFNRWYSMIQPALLAPEVMADPSKTNQFDEYK
KAYIKRIDECENYHQAFKVAGDYHNTTTAIFSTNTDNKALDACVWHGGNK
LDANKVESWQVTDHENKSWFGDGTVELVVSKADKKISDSGGRVNSDSYTL
GEPQIPGDGTVHMGLGENMPIIVNKEPIDATEDHQNFYNCPKVRTQVNGF
IQACIEDLNKKRD
9prot-q0ez31: Mariprofundus ferrooxydans PV-1 Esterase/lipase/thioesterase family active siteMariprofundus ferrooxydans PV-1 Show
MSAQPTVVLIHGLFGFDRLLWLEYFRQARSLYGQMGMRVIVPKLPWAGTI
KQRASALAEQLATQPGPLHLIAHSMGGVDARYWITHLGGGAKVASLTTLG
TPHHGSPVADHVCSTLSPFRLFAGVHALTTIAMRQFNADTPDHDGVIYRS
YAGARPLAQLPWLMRRYARIIEQAEGDNDSQVSRQSAAWGDLVSVVPADH
FELMSLNIWLNPFRRREPFDPLPLYRDIGCWILQQQ
9zzzz-a0a0g3fj44: uncultured organism EH145 Uncharacterized protein, 1 reference(s)uncultured organism Show
MKKTALKFCIFAIALTVSVLGASLAFSADTSCKTKYPIILAHGMGFTPTP
ASPHSFPGIVEALKACGATVYYTTVPALHTNAVKSATFKQQFMAIKAVDG
SAKFNIMGHSQGGLYTRYAISNLGIAPYVASLTTAASPHRGSFIGTVLLT
ITDVFPVLKPLMEGFAMFPGDQTYAEQNERELTINYMTKVFNPNTPDMKG
VYYQSFAVAFRQYSIIRTVADQLAMFVKMIAGNQTEPTVEEAALALYDMM
ESTAAMSFYMGGGIGDGLVQESSARWGTYLGCEKGSIFSRGINHLDAVNM
QLRGQVWDAKAYWVNLAKSLKKKGY
accpu-c7rq29: Accumulibacter phosphatis (strain UW-1) TIR proteinAccumulibacter phosphatis Show
DVVFVHGLGGDSWTTWMSDKDNIASFWPNWLAEDVPDLGIWTLGYAASGS
KWKEESMPLADRGNQVLDLLYNEDLGQRPLVFITHSMGGIVVKQILRNAD
DLGVKRFASILKQTRGIAFIATPHSGAHIANFAELASAVYRTNEHVKELS
AHDPRLRELHGWFLNKYLENHAVVCRTYCEKRELRPEIPLLGIKLPKGIL
VVDETSAEPNIKGERAIPLDEDHISICKPADRSAQIYRGMLRFVRDCLTT
QDPS
aciad-q6f6x6: Acinetobacter sp. (strain ADP1) hypothetical protein, 1 reference(s)Acinetobacter sp. Show
MLHGKTTMTSLTPLHETYCKWDRTPPSQADVLEGLAQLVSTSLWGVHDIV
QIIQHEILKNTLGMSEQQSNRLLRIPQIQSFYNFSYGMLQRYGRMFIAPS
LRRIIEKFPNLHDKPLTPTLHFLVGALNGVLGDYLLKYQNPLALPMVLYD
HYGALQQGDLAGRVVIFVHGLCMNHTDWSRQNFGGIGERLLAQRDNNFML
YLSYNTGRRISANGRSLSNMLEDLINRNPGITSIDLIGHSMGGLVSRSAL
FYGKQNMYHWIQMVDNLVCIGSPHHGAVLERFGFSLQERLGRFPFVKLIG
HLVNIRSNGILDLRHGSVRDDDWEHLEARIGLMDDNRKPAPLPTHINTFL
IAGTVEFKNVKNKALSIIGDYLVSVKSALGEHPNPRFQLKLPDSHKAVFH
GLNHFEIQYHSSVSEQITRWFYPEHDDYANSGVQTHMINMPDQAEPQLHG
IVET
aciad-q6fal1: Acinetobacter sp. (strain ADP1) hypothetical protein, 1 reference(s)Acinetobacter sp. Show
LAENNLGVSAYLSLIDRDQRLMMPHLYMLEPYNPQKKVIVLVHGLASSPE
AWIALTNDIMGDNILREHYQVWQVFYSTNMPILESRFQIYALLKQAFDSL
NPNDPADHNAVLIGHSMGGIISRLLVSQADISQKAFSLVSPYQQAQLKKQ
PMVYQRLKIQPIPNFDRAIFMSAPHHGTDFADLWFTRAARKIIKLPGAFL
GAITDTVTNENIDAKDLLLRIDQGLIQNGPSDLSYKSKFIELTKNINPPS
GFVFHSIIGNNTKSDDPEKITDGIVPYKSAHLEGSASEKIIQGGHSIQET
PQAVLELRRILRLHLKEHQIQ
acide-c5tag9: Acidovorax delafieldii 2AN PGAP1 family proteinAcidovorax delafieldii 2AN Show
WRQPFRHDAVPDWLPPLPPGQTPRRGVVLVHGFLCNRGFWLPWMAALRER
GHAHVAVTLEPAFGSIDDYAATLDAAVQRVTQATGMAPVVVGHSMGGLVA
RAWLRTLPAQAAATRVHRVITLGTPHGGTWAGRFSRAVNGRQMSLAGEWV
GALQRAEPAERAALFTCWYSNCDNIVFPASTAALPGADNRFVEGLAHMQM
AFDPRVMQACLEEMGRE
aciet-b9mcl3: Acidovorax ebreus (strain TPSY) (Diaphorobacter sp. (strain TPSY))Acidovorax sp. (strain JS42) PGAP1 family proteinAcidovorax ebreus Show
MTNARWQRWAVAVHLLLIAGWMAWFWGRSPALALAGVAAVPLMFRLGMAP
QFFLMAWVCRGDATPRPRAGQLLRAWWAESRWASLVFGWWQPFRHQAVAD
WLPPRASDVPGPRGVVLVHGFLCNRGFWTPWLALLRARGHAFVAVTLEPA
FGSIDDYCRTIDDAVRRVAEATGRAPLIVGHSMGGLAARAWLRAVPGSEQ
RVHRIVTLGSPHHGTWPARGARSTNGRQMRLHGPWVRQLGQDEPPARAAV
FVCWYSNCDNVVYPPAAAMLQGADNRFIEGVAHVEMAFHPRVLQDCLALL
EQP
aerhh-a0kkj8: Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240) Putative lipase transmembrane protein, 1 reference(s)Aeromonas hydrophila subsp. hydrophila Show
MPDWSDDWAMTITKQLLILLLVEVTLLGGIAHLVIGLSPPLSIPFVVVAL
LGLRTLVVVLTWGFSRFYPVPAIGWREWLPMVGREIGAYLLTFTWLLPFE
RWLMAPDRLTPSPLPLLLIHGYGCSRGIWRVQRARLEAAGYTVATVTLTP
PFGHLDDMVPLLAKRIDEVLAATGASQLVLIGHSMGGLVCRDYLAVAGGD
KVARLITLATPHQGSQLATLGLGDNAREMEPGSGWLQRFAAVPLCVPGVS
VRTSHDNFVLPQSRQRLDGMEDVELAALGHLSLLYSRRTTALLLTLLSRP
QPQMKRA
aers4-a4smh7: Aeromonas salmonicida (strain A449) Putative lipase transmembrane protein, 1 reference(s)Aeromonas salmonicida Show
MTITRQLLILLLVEVMLLGGIAHLVIGFSPLLSLLFVVLTLLGLRCLVVL
LTWGFSRFYPAPAIGLRAWLRMVVWEMLAYLFTFTWLLPFERLLMTPDRL
TPSPLPLLLVHGYGCSRGIWRVQRARLEAAGHVVATITLTPPFGHLDDMV
PLLARRIDEVLAATGAAQLVLIGHSMGGLVCRDYLALAGGGKVAQLITLA
TPHQGSQLATIALGDNAREMEPGSGWLQRFAAVPLCVPGISVRTSHDNFV
LPQSRQLMAGMEDIELAALGHLSLIYSRRTTALLLTLLARAQPETKRA
ailme-d2hdi6: Ailuropoda melanoleuca (Giant panda) Uncharacterized protein, 1 reference(s)Ailuropoda melanoleuca Show
MFLQSVSLWNLAFYVLMVFMATLGLWDVFFGFEENKCSMSYMFEYPEYQK
IELPKKLAKRYPAYELYLYGEGSYAEEHKILPLTGIPVVFLPGNAGSYKQ
VRSVGSIALRKAEDIDFRYHFDFFSVNFNEELVALYGGSLQKQTKFVHEC
IKTILKLYKGQEFAPKSVAIIGHSMGGLVARALLTLKNFKQDLINLLITQ
ATPHVAPVMPLDRFITDFYMTVNNYWILNARHINLTTLSVAGGFRDYQVR
SGLTFLPKLSHHTSALSVVSSAVPKTWVSTDHLSIVWCKQLQLTTIRAFF
DLIDADTKQITQNPKKKLSVLNHHFIRHPAKHFEENPAIISDLTGTSMWV
anade-q2ipl0: Anaeromyxobacter dehalogenans (strain 2CP-C) pgap1-like precursorAnaeromyxobacter dehalogenans Show
MPAWPGAGAAACCAAMGARVDVTDLRGWGRLAFDATLGVTAVVEGMHHNI
SRGPWFLDAPRSARTRGLTGLVYGAVRGITRLAGEGYDAAVSRVAGRAGQ
AGSPRREAVLAALNGVLGDHLAATGNPLAIPMQLRFEGRPLALEARALRE
AIPGATGKVVVLVHGLCTEPLRWRRRGHDHGAALARDLGYTPLYLHYNSG
LHVSTSGRGLDEVLEALVRAWPVPLEALSLLGHSLGGLVVRSAWHQGAAA
GHAWPRRLGSAVFLGTPHHGAALERGGNWIDVVLGVSPYTAPLASLGRIR
SAGITDLRHGNLLEEDWQGRDRFARSPDRRRHVPLPPGVRCLAIAGTTAR
RRSAAADLLGDGLVPLASALGRHREPARTLAFGPGGRAIAPGVGHLELLC
DAGVYERVRRWLAA
anoga-q7psq5: Anopheles gambiae str. PEST ensangp00000014894 (fragment)Anopheles gambiae Show
MLFRLLIVLPVLAVALFLYGAIVSIGYIEENRCRMTYMFEHPQYTRLPVQ
GNERFPKYGLYAYSEGFVTQRVQQRLFTGAPVLFVPGSGGSYKQVRSLAS
VALRKGLDNNWQAHLDYFSVDLNEELSGVYGGYLQDQTDFLDLCIQEITR
LYGARGRTTRLFIVGHSVGGKLAQAVVGARTSIGRHVAGIVTLSAPVDKP
VALFDHYHYSFYDRIEQAWRTNRSLAGAANASPSHGLLPLDGILFVTIGG
GIRDIIVHDGLTASRYADLHAMTHNIPNVWLSVDHLCAMWCLQFVLVMNR
FLFSM
arath-At3g27325: Arabidopsis thaliana (Mouse-ear cress) At3g27325 similarity to negative regulator of vesicle formation, 1 reference(s)Arabidopsis thaliana Show
MEDFGDTGLLIEYEMIFMQIYTIEMRDVRFAMSIRPRLRIVGVLILAAWI
GLVALFGLLKPIKNGCTMTYMYPTYIPISVTDDTTPGRYGLYLYHEGWRK
IDFKEHLKKLSGVPVLFIPGNAGSYKQVRSVAAESDRAFQGGPFERTFYQ
EASLLRGGGADTESVDYDLPSQYSNRLDWFAVDLEGEHSAMDGRILEEHT
EYVVYAIHRILDQYKESHDTREREGAAASSKLPHDVILVGHSMGGFVARA
AAVHPRLRKSAVQTILTLSSPHQSPPLALQPSLGHYFAQVNREWKKGYEV
QTSPGGNYVSDPLLSGVVVVSISGGYNDYQVRSKLESLDGIVPSSHGFMI
SSTSMTNVWLSMEHQAILWCNQLVVQVSHTLLSMVDSKTNQPFSDTDKRL
WVLTRMLQSALAQSFNGMTP
arath-At5g17670: Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) MVA3.2, At5g17670 Hydrolase-like protein, 2 reference(s)Arabidopsis thaliana Show
MASAMVTSLRLRPNFSAATSPSSSSSAGNVKYRPAVILPGLGNNTGDYKK
LEVTLGEYGVPAVVAAVSRLDWFRNAAGLVDPAYWRGTLRPRPVLDWYLN
RIDDAVREANELAQGQGLCLIGHSAGGWLARVYMEEYGNSDISLLLTLGT
PHLPPPRGLPGVIDQTRGLLYYVEENCAKAVYTPELKYVCIAGRYIRGAR
LVDNADADIDSDVTVGIDSGEGISELAIASNKKSGTFRARFVGQGYKQVC
GRADVWGDGVVPEVSAHLEGALNVSFDGVYHSPVGSDDETRPWYGSPVIV
KDWIHHLLE
ashgo-BST1: Ashbya gossypii (Yeast) (Eremothecium gossypii) afr521wp, 1 reference(s)Ashbya gossypii Show
MCSVLRFQRNMASWVKRHVFTFDLGDIQEKRGSDSGSGQSRSTADRYFNA
VFGLGLLLFCIVCMAYLSPFLGSDLPQCRSRTMYPSYALVQGFDRRFSRL
GRKYHLYLYREAGKDNGFSDDNEIHLDGIPVLFIPGNAGTYKQVRSIAAA
TANLYYGEMRDALNNNNTKNLDFFTADFNEDFTAFHGRTMLDQAEYCNDA
IRYILSIYELSDKYRASGEPLPTSVLVVGHSMGGIVARVMTTLKNHIPQS
INTILTLSSPHSTAPATFDGDILKIYNAMNAFWESKFRDRDKDPFYAENV
SVISITGGVLDSVLPADYTSLEGIIPSDNGFTTYTTTIPWVWTPIDHLAI
VWCDQLRIVVAKLLLELVDRTSASKTRPLPDRMRLARRSLLSGLESSASA
DFHLWDNE
aspfu-q4wgm4: Aspergillus fumigatus, Neosartorya fumigata, Neosartorya fischeri (Aspergillus fischerianus) gpi maturation protein (bst1), putative, 1 reference(s)Aspergillus fumigatus Af293 Show
RSSRLRSPWTCSILTALTTLVASVFLFFIVRSFSARQAGEDGCGIPVMSP
TFLHMVGFDTEHTRFASKYNLYLYREEGVDFYNQENLGLNGAPVLFLPGN
AGSYRQVRSLAAEASRHFHDVVRHDQERIKAGTRSLDFFMIDFNEDMAAF
HGQTLLDQAEYVNEAIAYILSLYHDPKRSRRDPELPDPSSVILIGHSMGG
IVARTALTMSNYQANSVNTIVTMSAPHAKPPVSFDSDIVHTYKQINDYWR
EAYSQTWANNNPLWHVTLISIAGGSRDTVVPSDYASISSLVPETHGFTVF
TSSIPDVWIGVDHLSITWCDQFRKAIIKSLFDIIDVRRASQTKPRAERMR
IFKKWYLTG
aspor-q2usi0: Aspergillus oryzae negative regulator of copii vesicle formation, 1 reference(s)Aspergillus oryzae Show
MTSNPPDCKSSSVMMPLASQRLPIEASPDHQRRYRPSRLRSPWPCSILTA
FTTLVASIFLFFILRSFALRQTGGDGCGVPVMSPTFIRMVGFDTEHTRFA
SKYNLYLYREGGVDPYSQENLGLNGVPVLFLPGNAGSYRQVRSLAAEASR
HYYDVVRHDEDRLNAGTRSLDFFMIDFNEDMAAFHGQTLLDQAEYVNEAV
AYILSLYHDPRRSRRDPELPDPSAVVLVGHSMGGIVARTALTMTNYQANS
VNTIVTMSAPHAKPPVSFDSDIVQTYKQINDYWREAYSQTWANDNPLWHV
TLISIAGGSRDTVVPSDYASISSLVPETHGFTVFTSTIPDVWIGMDHLSI
TWCDQFRKAIIKSLFEVVDVRRATQTKPRA
asptn-bst1: Aspergillus terreus (strain NIH 2624 / FGSC A1156) GPI inositol-deacylaseAspergillus terreus Show
RPARLRSPWPCSILTALTSLLASLFLCAILRSFAARQTGGDGCGIPVMSP
AFLHMAGFDTEHTRFASKYNLYLYREQGVDPFNHENLGLNGAPVLFLPGN
AGSYRQVRSLAAEASRHYFEVVRHDQERLRSGTRSLDFFMIDFNEDMAAF
HGQTLLDQAEYVNEAVAYILSLYHDPKRSRRDPELPDPSSVIIIGHSMGG
IVARTTLTMSNYQANSVNTIITMSAPHAKPPVSFESDVVHTYKQINDYWR
EAYSQTWANNNPLWHVTLISIAGGSRDTVVPSDYASISSLVPETHGFTVF
TSTIPDVWIGMDHLSITWCDQFRKAIIKSLFEIVDVRRASQTKPRAERMR
VFKKWYLTGLEPIAERTLSQ
bifdb-d2q844: Bifidobacterium dentium (strains ATCC 27534 / DSM 20436 / JCM 1195 / Bd1; ATCC 27678) Alpha/beta fold family hydrolase membrane associated protein, 1 reference(s)Bifidobacterium dentium Show
MTTEASWLAVDTIIITAVANCVLPLESAHLDGAATAMNVAVAVVLAAAVI
MIPGNPTHPKTLRARNLKICYRGTAALKAFWWSAALSIVVQTVLAFHLLP
SGWKLWLGSAIICFLVESLLFWRGMIAVYVSSVQLGLKIRAIGLICGWIP
IANLIALVRIIRTTDAEVVFEEAKERLDADREAERICATTYPILLVHGVF
FRDSNVLNYWGRIPDELRKNGATIHYGNHQSAASVRSSAYELTERIRQIV
ELTGCGKVHVIAHSKGGLDMRYAIARCGAAPFVASLTTINTPHRGCGFAD
YLLSNIPEAVQRQVEAAYNAAAARLGDPQPDFMAAVHDLTQAGCARLNAE
MQSESANPPQRKQTEAHADAVRSPMPEPLNNSRFAGMVCRSVGSRLKHAT
TGKFPLNFTYPLVKWFDGPNDGLVARSSFLWGESFTWIEPQGDRGISHAD
MIDLNRENIPGFDVREFYVQLVADLKRRGL
bovin-e1bnq0: Bos taurus (Bovine) Uncharacterized protein, 1 reference(s)Bos taurus Show
MLLHSVNLWNLAFYALMVFMATLGLWDVFFGFEENKCSMSYMFEYPEYQK
IELPKKLAKRYPAYELYLYGEGSYAEEHKVLPLTGIPVLFLPGNAGSYKQ
VRSIGSIALRKAEDIDFKYHFDFFSVNFNEELVALYGGSLQKQTKFVHEC
IKTILKLYKGQEFAPKSVAIVGHSMGGLVARALLTLKNFKQDLINLLVTQ
ATPHVAPVMPLDRFITDFYMTVNNYWILNARQINLTTLSVAGGFRDYQVR
SGLTFLPKLSHHTSALSVVSSAVPKTWVSTDHLSIVWCKQLQLTTVRAFF
DLIDADTKQITQNPKKKLSVLNHHFIRHPAKHFEENPSIISDLTGTSMWV
bovin-srac1: Bos taurus (Bovine) Protein SERAC1Bos taurus Show
ADVLFIHGLMGAAFKTWRQQDNDQDLTEKVSEDETKYTTCWPKSWLARDC
PALRIISVEYDTSLSDWRARCPTERKSIAFRSNELLRKLRAAGVGDRPVV
WVSHSMGGLLVKKMLLEASKRPEMNTIINNTRGIIFYSVPHHGSHLAEYS
VNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLSFVETLPT
YIGSMIKLHVVPLDSADLGLGDLIPVDVNHLNICKPKKKDAFLYQRTLQF
IRDALAKDLEN
caebr-a8y4l4: Caenorhabditis briggsae hypothetical protein cbg23146, 1 reference(s)Caenorhabditis briggsae Show
IAAVGIGVGAYLHVTVHSHNSCSMTFMYRKLQFLDIPVPDNEVSHYSLSV
YNEGYRWWNRSTIDINQIPVLFIPGSQGSAKQVRSIASVMQNKTEMRQSV
FSFRFFAVDFDEEKTFMNGHTVNRQLDYVMKAIRKIQSLMRVKRRIVLIG
HSYGGMVALLTTVHPDFHDDIELVIVKGAPITKTPILNDWTTLRLNKLLT
TKWDLLQASDLKHVGVVAYTGGLRDFQIPDEWSIMRNVTHRPIWAVGGVS
DLGADHLAILWCNEFVRHVSRVLYFYGEHFNKWTGRRVVQTFY
caeel-T19B10.8: Caenorhabditis elegans t19b10.8 protein, 2 reference(s)Caenorhabditis elegans Show
QENSCSMTYMYRKLEFLEIPLLTPQSDKYSFSVYNEGHRWWNRSTIEAGQ
IPVLFIPGSQGSGKQIRSLASVMQNKTEMRYAPFSFRFFAVDFDEEMTFM
NGHIVKRQIEYVMKAIRKIQSMMRGNRKIVLVGHSYGGMIALLTTIYPEY
QKDVELIIVKGAPLNKQPLVNDWFSLRFNLLLVNQWNALQNNNLSHVGVV
AYSGGIRDYMIPDEWSILRNVRAVIMKVTIKFSAQVTNRPLWAIDGVSDL
GADHLAILWCNE
canal-q5ai09: Candida albicans (strains SC5314; WO-1) hypothetical protein tgl2, 2 reference(s)Candida albicans SC5314 Show
MIRSIRFYSKVIDLKKEGKTAAKILKSEYKSLKDHYEAPKYPIVLCHGFS
GFDRLSLLPIPKEVGHQIDKAKEYAPRGLIELDYWYGIKEALEKLGSTVF
IAKVPAFGDIKSRAVSLDKFINKECKSLRQNESKSSIYNDSNHDPTTFEN
KNEPIKVNLISHSMGGLDSRYLISKIHKENENYKVASLTTISTPHHGSEC
ADFIVDLIGNNQILKNVCPQSIFDLTTSNMKKFNQSVKDDPNVQYFSFGA
RFNPRWYNLFSLTWLVMKYEIKKDKARELRRLIDNDGLVSVESSKWGQYI
GTLDEVDHLDLINWTNKARSTFDKVMFAQDPTFNPIALYLDIADKLAEKG
L
canal-q59vp0: Candida albicans (strains SC5314; WO-1) hypothetical protein bst1, 2 reference(s)Candida albicans SC5314 Show
MLSKRLFPYSNLFPRSRKYKFIVYFIICLTIIISALGVYLYSIPIVSPNQ
PQCDMVWMSPSYARIRAFDETHTKYASKYNLYLYREQDVDKMPNENENED
GNEGFTSLDGIPALFIHGNAGSFEQVRSIAARCSEMYYTDGKFKEKYPHA
RNIDFFTADFNEELSAFKGLRDQVEYVTQAISFIVDLYPQNPNRNIILIG
HSMGGLVARIAASRQQHESNVDIILTLATPHSDPFPWLPKTSDFPDEVGL
ISIYSSVDLMVPPSVVTPKSKSDHFFSVDAAKLLGVPIDHQGIVWCGQLR
EKLSEALIGISGLNTLQDRMKVFKKIFSGDRKELGPTPIFGLAKLKLKLL
QSWVHLLSLTIFALKWTIIVLAIIQLRKVYTKFNNPPPTH
canfa-e2r8v9: Canis lupus familiaris (Dog) (Canis familiaris) Uncharacterized protein, 1 reference(s)Canis lupus familiaris Show
MLLPSVSVWNLAFYAFMMCLASLGLWDVFFGFEENKCSMSYMFEYPEYQK
IELPKKLAKRYPAYELYLYGEGSYAEEHKILPLTGIPVLFLPGNAGSYKQ
VRSLGSIALRKAEDIDFKYHFDFFSVNFNEELVALYGGSLQKQTKFVHEC
IKTILKLYKGQEFAPKSVAIIGHSMGGLVARALLTLKNFKQDLINLLITQ
ATPHVAPVMPLDRFITDFYVTVNNYWILNARHINFTTLSVAGGFRDYQVR
SGLTFLPKLSHHTSALSVVSSAVPKTWVSTDHLSIVWCKQLQLTTIRAFF
DLIDADTKQITQNPKKKLSVLNHHFIRHPAKHFEENPAIISDLTGTSMWV
canga-q6fly9: Candida glabrata (Yeast) (Torulopsis glabrata) candida glabrata strain cbs138 chromosome k complete sequence, 1 reference(s)Candida glabrata Show
VFGIGLFLIIAILTLWWPLTGADLPQCHSIYMYPSYARVDGFNEKFTSLA
NKYHLYLYREQGMDKEPLNNGEIQLDGIPVLFIPGNAGSYRQVRSIAAAC
SELYFKQSDILINKNAKNLDFFAADFNEDFTAFHGGTMLDQAEYLNDAIR
YILSLYDQPDVSTTLAKPKSVIIVAHSMGGIVARLMPTLKNHIHGSVHSY
LTLSSPHAAAPITFDGDVLQLYKRTNEYWKRELNDKSSFIFNNVSLISIT
GGIQDTILPADYAMIEDLIPYSNGFTVHTNTIQDVWTPIDHLAIVWCKQL
REIISRYLVETSNI
chagb-q2gtl6: Chaetomium globosum CBS 148.51 hypothetical proteinChaetomium globosum CBS 148.51 Show
MRRLPVAHRPASWLDPFASVRRYAGDQTTICRSAGPRRHLGAYAPLCRHF
APTDARIKGLGKEIADEYALLRDSYRFAELKLAGSYLPSIHYWRGIREAL
SANHAEVITASVPPSGSIEKRAAKLAEDIEAQARGKSVNIVAHSMGGLDA
RYMISRLQPTGVKVKSLITVATPHHGSPFADYLIDGIGPNYLPRLYQLWE
RTTGWEPNAFAQLTTKYMAEEFNPKTPDDPTVRYFSYGATVKHKPPLLSP
FRHSHRVIEEREGPNDGLVSVESSKWGTYKGTLLGVNHLDLINWSNRLRF
TVQKWMGHPPSSSDIG
chagb-q2gw21: Chaetomium globosum CBS 148.51 hypothetical proteinChaetomium globosum CBS 148.51 Show
MQRAPIPGSGSSMVDNSDAAAGPISSFGALNLSKNSDPDGLSGPQWSYRD
PRTSSTHSLVPSADDGDEDNRKRRLLVVYIHGFMGNNSSFRSFPAHVHSF
LKNLLVETHVIHTKIYPRYKTYKSIDVACDNFSKWLAPHESPTTDVVLIG
HSMGGLLAADVVLLPRNNPYDTSHPFRHRILGTISLDAPLLGLHPGIVVS
GIASLFRPAPSPPGMSEEAQPDYLQPQGLSPDPSIYSEVSPPSGASSPAL
NAYP
chagb-q2h102: Chaetomium globosum CBS 148.51 hypothetical proteinChaetomium globosum CBS 148.51 Show
RRPPWRSPWAITFSALVAAIVGIGFLVAVLHSSVTRQLDPKGCRMSYMRP
SYAKLNEFDTEHTRLASKYSLYLYREQDIDRDTKVRGVPVLFIPGNAGSY
KQVRPIAAEAANYFHNVLQHDESAMNAGTRNLDFFTVDFNEDITAFHGQT
LLDQAEYLNEAVRYILSLYLDPRVADRDPDLPDPTSVIVLGHSMGGIVAR
TMLIMPNFQSHSINTIITMSAPHARPPVSFDSQSVQTYKDINDYWRRAYS
QQWANDNPLWHVTLVSIAGGGLDTV
chagb-q2hht3: Chaetomium globosum CBS 148.51 hypothetical proteinChaetomium globosum CBS 148.51 Show
MVQVDQPRRNLFSTLLARPTTGTRSERSTSPSSLPSSSVEPKKDELKGAI
GLTTIHEPPSPEETSAEIVFIHGLGGGSRKTWCYSSDPEHYWPQSWLPAD
KDFMGVRVHVFGYKGDWLERRESVLGIHDFGQSLIDAIRNHPGILQVDTR
IILVGHSMGGCVAKKAYILARQDPATADIARRMHSMFFLATPHRGSNMAA
ILENMLAVRWGKKPFVTELTPNSTVLSAINDTFRHFAPEL
cloac-CAC1028: Clostridium acetobutylicum lipase, 1 reference(s)Clostridium acetobutylicum Show
MTFLISFISFILLISVILLDIGKKLPLLNKAFMSIYLIFAPHIVLIYYLI
NHHTNIGQTNIVCKWIISIEIFFFIFYVWLKANLFPSIKKQAASLRLRIM
IGGERIVLFGLYTSLIQILLYIVYLVKMRDAAPIHIFVIDLILAIIAILI
LLTNGMIRILCTSKRLNIAKRFIVGFVCFIPIINIFAMLYACHTAKIEYD
HDLYKVITNKERVDSHVCKTKYPLVLVHGVGFRDLKYINYWGRIPKELIR
NGATIYYGNQEAWGTVEYNAQYMKNKILQIIKETGCEKVNIIAHSKGGLD
SRYMVSKLEMGKYVASLTMMSSPHRGCKFVDIACKIPDKIYRAVSNFFDK
YYKILGDKNPDFYTASRQFSTYSSSKFNEEVKDVPGVYYQSYATAVKNIF
SDYVVSIPYVLSKLTSGENDGLVSIDSAKWGHFKGVIRNNRRRGISHGDI
IDLRREDYKGFDVLEKYVEIVSDLKEKGF
cloth-a3dhx6: Clostridium thermocellum, hydrolase fold precursor, 1 reference(s)Clostridium thermocellum ATCC 27405 Show
MSVRQVRNRKIFIMIALSLFLLFVHFRQINAFFIGAFYNKNNLNIYLDLI
NSQVHTISSEPSNKVYLKAVVKDANGKLIPHIEVNFEASKGMGTVQPAKA
ATDSRGECFVTYVPEYYYNLSPDANPRHVVITASIAGTDTNSTVKLNLVP
APVVFVHGYRETADVFDNLNEFISSKGYTCISLNYDSTLGIEHSAKELEL
FLQKQKKDFLSQGILVNKFDLITHSMGGLVARYYSASQNYLKNDDINKII
FLSVPHKGSVLASIGEEYFKDKSIKELVPDNELFVSIFPNTINGGLNNSI
QTGNLLSQYDEVVTNESAALDKWGIKTEIFNVGENSFTVHNLLSGNILDA
PNHKGILNNSTVFNRIAEMLNTNLPYPAVINK
cocim-bst1: Coccidioides immitis (Valley fever fungus) GPI inositol-deacylase, 1 reference(s)Coccidioides immitis Show
RRARTRNPWICSGLVLFVTVSALLILSIIVYSYQSLQVDPQGCRTPSMRP
TYIKLVGFDSEHTRFASKYGLYLYRERGVDEYSEEDIGIKGVPVLFLPGN
AGSYKQGRSLASEASLYFHDVLQYHQERLKTGVRGLDFFMADFNEDMAAF
HGQTLLDQAEYVNDALAYILSLYHDPRRPGRDLNLPDPTSVILIGHSMGG
IVARTVLTMSNYQTNSVNTIITMSTPHARPPVSFDSDLVHTYKQVNNYWR
EAYSQKWANNNPLWHVTLISIAGGGGDTIVPSDYTSLSSLVPETHGFTVF
TTTIPNVWTGMDHLSIAWCDSFRKVIIRSLFDVIDVRRSSQTKQRADRMS
VFKKWYLTGMEVSAERKL
comte-b7wsd9: Comamonas testosteroni KF-1 PGAP1 family protein, 1 reference(s)Comamonas testosteroni KF-1 Show
MNTWFWRCVVMGSWLALLLWCSYWGPRSAAVALLGAMLVAGGAGLQLGTQ
MLMMRAVLRSRGVPLPPAMVALRAWLSEWRWAWRLFGWQIPFGEHAEPDG
APEDREGRQEQGRVGVVLVHGYFCNRGVWAVWLRGLKARGIPCMAMTLEP
AHGSPVDAMVDDLDRCVKEIVQRTHRAPLLVAHSMGGLVVRAWLKRLDSD
QRARYAAHVVTVATPHGGAWLARFAQRLPAVDMREGSDWLQRLGQPPQDV
SFSCWCSSSDNIVFPPDLAILPNAQCHQVDDAAHMQLLFDPRVWQHCLQL
QAQLQGRPQARYQAAEAGASAAGAGARACGS
cryne-q5kf48: Cryptococcus neoformans (Filobasidiella neoformans) er-associated protein catabolism-related protein, putative, 1 reference(s)Cryptococcus neoformans Show
MPAWPRFMSLRRQYLYKALDKNHQKHPIKHPHTRFLSRLFCALAVLFSYS
IYQSFRTDLKQSGSWGCEMSWMSPSYRRLEWTEFISTRYALYLYREQGLD
SEDTLSGHPVLFVPGNAGSYQQVRSIASSASKQYYEQVKARERNVVTGKK
IDFFTADLKEEFSAFHARTVREQAVFIQHCIKGILQEYTHLPQEKRPTQV
TLLAHSMGGVVARLAMDPITSISVDIIVTLSTPHILPPLALERDMDSIYS
LIRWRRQHISTHPPLISICGGISDTQIVSDSCALPFFQAGNNSDIAVFTT
GIPGVWTAVEHQAIIWCHQIRWRIARMLLDMSSRANTTAKLVTAKEWLLD
YQEDETLKEPRSE
cupnh-q0kcu9: Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha) Predicted acetyltransferase and hydrolase with the alpha/beta hydrolase fold, 1 reference(s)Cupriavidus necator Show
MSLSAAGIRRLAVTLQAAAALGIAAGLVQLAGWPWPGAVAAGVAAILGSF
ASGIAFAFALSGRGLWVGRGNHPPAPPLELAATRRPLRLPEALRCFAAEC
VAVLRMFD