Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Prolyl_oligopeptidase_S9

Prolyl_oligopeptidase_S9


Genes:Proteins in Prolyl_oligopeptidase_S9 (189)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9baci-q2bdj8: Bacillus sp. NRRL B-14911 acylamino-acid-releasing enzymeBacillus sp. NRRL B-14911 Show
MLTFSKPDVEYFFQTFGIQTFAVSPDESQLVFSTNLNGKYNLWAMDLPNQ
FPYPLSFQNQSCQEIEYDKEGRFLLAVIDSDGDENGQVYALPRNGGELKP
IRTQENARHMGLIASKDGKTLYYTSSKEDATFLKAYAYNMETGEEKVLLH
GRGAATFLTAKSPDEKRFVFGRMFANTYSLAYAWDGEKEVLLTPEAEPQH
TVTDAVFTSENDIYLVTNYKEDLSYLAKFSLETNEFTKMLSLDGEDFSGL
KYDKKARTLYISSQKGAEDHLYRYGLEEGKAEQLELPASTIDGLSVAESG
NLYLLGRSAVTPPNLYKYAKGEWTQLTNNLVPGVSEEEMAEPEILHYPSY
DGLEIEALFFRAKEGNSNGHVILWPHGGPQAAERASFRSLFQFLVHRGYS
IFAPNFRGSSGYGLSYMKMVEGDWGYGPRLDNVEGLEWLIKNGYADREKL
LLMGGSYGGYMALLLHGRHPEYFKAVVDIFGPSDLFSFIESVPEHWKPVM
NQWVGDPVKDKEKLIEYSPITYLDTMTKPMLVIQGAKDPRVVKAESDKIV
AALQEKGREVEYLVLDDEGHGFSKKDNEIKVYRKVLEFFDGFIN
9baci-q2bf04: Bacillus sp. NRRL B-14911 prolyl oligopeptidase family proteinBacillus sp. NRRL B-14911 Show
METLTIENFMNIRNVKNPAYGPQGKMLNFISDASGIPQLWEIHAEGGNPN
QVLETAERIMFVSFIQGTGKRIFGMDEGVNEKQQLFLLTETGEVIRLTDS
PEHIHKYGGVSPDGKWISWASNRRHNTYFDIYIQSLESFEVKMVFQGDGH
FSPLQWHPEGNSLLIEQVNTNLDNDLGLLDLSGGTVQWLTKHEGEAAFAS
PAFSSDGKMIYMLSNRDREFMNLARLNLETLETKWLVEKEWDLEELKLST
DKKKIAFSINEGGVSKGALLDFESNEVTEWESPAGVITDFSFSPDNSRLA
FILNGPQHPSDIWELDLRSRKAKRATFISHDPLVEEKLCAPELISFASFD
GLEIPAFYYKPKKADGKLPVVVFVHGGPESQIRAVFNPFLQFFLDNGFAV
CTPNVRGSTGYGKSFTHLDDVRKRMDSVRDLVHLVDWLKTEGGAAEDQIS
IMGRSYGGFMVLAAITHYPDIWSSAIDIVGISSFRTFLQNTSPWRRKMRE
AEYGSIENDGAFFDEIDPLHKTDRIQCPLLVLHGANDPRVPIEETEQIVE
DLKNRKHPVEYIRFEDEGHFFVKRENNIKAYTASWDFLKEYSGRIKH
9bact-a0a1f6kk86: Candidatus Levybacteria bacterium RIFCSPLOWO2_01_FULL_39_10. Uncharacterized protein, 1 reference(s)Candidatus Levybacteria bacterium RIFCSPLOWO2_01_FULL_39_10 Show
MKKILGLICIVLLFVVALESLYIFQNQWFRKNIIEEISIIKRPLLSYTFE
NLKKTKFPKNQITFGPVISEDDDSFSQVFYFSVPKAPGENEMEKVSGLAT
IPKEEGEYPVIVMFHGFIPDDIYEPGAGTKPTASQLSKNGFITLAPDFLG
FGDSASPSAVHFEGRFQTYTTALTLLSSLITLNQGLEKDYVGTVSADLEK
IGLWGHSNGGHIALSTLAISGEAYPTVLWAPVSKSFPYSILYYTDEYDDQ
GKGMRKSLSHFEEIYDTDLFSPAKYYNLIKAPIQIHQGTGDEEVPYWWTD
ELVEILEENAQDVTYFQYPGANHNLFPSDWSEAVTNTIEFYKQGFSL
9bact-KY203037: uncultured bacterium EH120 clone 00152_2_12ROV11 esterase/lipase, 1 reference(s)uncultured bacterium Show
MAKRENRKGLRHFPISVSGILVFLLMAVSGFGQGPLCIPVEYQTSPFFVH
FRGAGNPTLVVIHGGFSSTLQADLFCCEFARILGQRYNIISVDYRFSSLG
GGELVDVLRGINLAENRWRTPKSQIHLIGASHGGFLALMAASQEEVGSVI
DAYGPTNWLIQWRYVREHRPDILKRWRIYLAISRSACRDMNLEFNQCLVQ
RSVVNPRHLQGLQEPILILHGAKDRLVPVKESKLLARELKKRGRKVTLVI
LPQRGHAFPLWKGKPLGLVERLLKEEEGR
9bact-q6wlc7: uncultured bacterium csw020, 1 reference(s)uncultured bacterium Show
MRADSKGDEMRISARWSMVCHALLLASSLCLMATQARAQAAPEPLKPPST
QDFSQLPMVMDLSLSPDGQHVAGLLNIDDKTLLFTRGVHDQKLVYLSSTD
NKAFKIAWLQWASNDRLVFGLRFAASRDFIGTVETRLMSVKRDGTELINL
VSTSPFSSNRFQSQFQDRVIDWLPGDGHHILMELNEGYSYSPAVFKVNLD
TGMRQMVHTPKRHVRNWVTDQTHRVRLGVLHDEAKREVQVCDPDGKNWRT
LWRYEVFSKDAIYPLGFGLNPQELYISANHEGRLAVFKVNLASPDLQHEL
VLSHAELDVSGQLIRSQATGQIIGIHTGIQDEQRPDFWDPSLRLLARAID
KALPERFNSLIELSRDEQHYLIYSVGNGKPGEYYLGNRKTGDLALVAETH
PELPQASLVGKQPVQIKARDGLVLTAYLTRPAKSPGALPLVLLPHGGPDS
RDNSRFDVWTEFLASRGYAVLQVNFRGSAGYGHDMMVAGLQRWGLEMQDD
LSDAVQWAIAQGVADPKRVGIVGFSYGGYAALMGSVKTPDLFRCAVSVAG
VTDLIDLWYHQNQYIGGAAIADKQIGNAWNDRKRLTETSPALQAERIKVP
VLLIHGTDDRTVPFEQGEAMDKALRRAKVPHRFVELEGGDHQLSRNSHRL
MVFKELEDFLAQNMGAPKVLAQQQQP
9burk-q3ffa4: Burkholderia ambifaria AMMD hypothetical proteinBurkholderia ambifaria AMMD Show
MTAEHYRVRIKVENGYLDGTVLAPKTTVAGVLFVHGWGGSQEQYLERARQ
AAALGCVCLTFDLTGHGRTLEEQQNVTRETHLRDLLAAYDTLVDHPLIDR
DAIAVVGSSYGGYLATILTELRPVRWLGLRVPALYLDDGWNTPKRALHVE
HDLVAYRKRIVPASDNRALRAASRFRGDVLLVESEHDQIVPHTAIASYLQ
ACLSAHSLTYRILEGADHGLSDAASQSAYTALVEKWLVEMITGQRAGVRG
SAAPGPTDA
9delt-q2djm8: Geobacter uraniumreducens Rf4 dipeptidyl peptidase IVGeobacter uraniumreducens Rf4 Show
MIIHWYGGPTQQLVSNRYGATNIFNHIERDVLYTQEGFIVWRLDNRGSFG
RGHRFETPIYKELGKAALDDQLAGVEYLRTLPYVDASRIGTDGKSFGGFL
TLYGLIHAPEVFKVGVDGSGPTNWAYYDTIYTERYMQTPSDNPAGYAATN
LITIADQLMAAPLIIHGLADTNVHLENSINLIQVLEQYDKPFYFVPLPNE
DHHYAGDGLATALAASVNYFVQNLGGHP
9eury-e7qv35: Haladaptatus paucihalophilus DX253 Peptidase S9 prolyl oligopeptidase active site domain proteinHaladaptatus paucihalophilus DX253 Show
MSDARYPLTRYLGIDSAGSPTMTIDGSLVFLADTTGTPQVWSLDEPGAFP
SRLTAHDERVSFVSASPTRSEVVFGMDTGSDEHDQLYRYDLDSGTETALT
ATPEAIHLWGAWSPDGDRIAFTANRREGSTFDVYVQGRDDAEATLVHEGP
GGFLSVEAWGEPGIVCSKANASFDQNLFLLDPESGDYRKLTDDTDARYHD
VTFGPDDDLYCVTNHGADTAYVARLDLDDGAPTVVEEAGDWNVSHLLLHG
GTGRVVWVRNVDGYSEVHAGRLTAGDDIEPLSTPDLPDGVVFAAGFGPDG
DCAISMSRSDDPKNVFVLNPDTGSAERWTNFGTLGIPRETFLDPEIVRYE
SFDGREIPAYWTLPPNAEPGETPVIVDIHGGPEHQRQPWFYPTKQYFLQH
GYAVLEPNVRGSSGYGTAYTHLDDTDKRMDSVADIEAAVGWLHERDAVDA
DRIVAYGRSYGGFMVLAAITEYPDLWAAAVDFVGIADFETFLENTGEWRR
SHREQEYGSLENRDLLRSISPIHEAERISCPLFIQHGANDPRVPVGEAKQ
IAERVRERGVPVETCIFEDEGHHTTSRENLIDEFERIAAFLDEHV
9firm-q3ger7: Syntrophomonas wolfei subsp. wolfei str. Goettingen esteraseSyntrophomonas wolfei subsp. wolfei str. Goettingen Show
YILYREGPEKPWKRLIEFDLSLTRDYEIIGFSADNTKMIVKTNFYDNYAS
LYQVDPETMSRELIYHNSHADVAVELVSVLAGTPVVSLKNPETGELLTAI
YIDDKTRLVCLRDEMATIMDNVRADLGENQFPVAISPDFDYLVLLHRDDR
DYGSYRLYNVESRKDTLLLSSDIPIKDVGHSYPVSFKASDGHTVFGYLTL
PPGKSPRNLPLIVNVHGGPQARYVWTPNEYALLASNLDIGVLSVDFRFSI
GYGNEYSDSASKNMPLAQQDVFESVNWAINNGIADPECIGIMGHSYGGYI
SFYQAAVHPDVYKAVISLMGVWDWTDLGLELIQDDPVPDYHRCSAPEPYT
ELAQVLSPSSYADKLKSPILIIYAGQDDAVYPSQNIRAIKELTEAGNTPQ
VLYLPDSGHTPDTLENITAVFEEIKSFLDEQMKANPWIISRRNASEN
9flao-q1vt84: Psychroflexus torquis (strain ATCC 700755 / ACAM 623) prolyl oligopeptidase family proteinPsychroflexus torquis ATCC 700755 Show
MVNGQTINGDWSGKLNAMGQEIPLVIHFSGNDDNLTATMDSPSQGATDLP
VEKVSLEGTQLSLSLMGGQIEYTAEVNGDSMTGNFKQSGMDMPLTLTKGE
LEKPGDTSLPSSEEEMEALANKETGDYNYSVADYFAKPASSEFQLSPDGT
YLSYREKDDNLKNHVYVKNIKTNDVQRVITEAEELIRGYGWANDKRLIYI
MDKGGNEDYHLFAVDIDGNNQKELTPYDGVKVEILALLKEDKNHMVISMN
KNNAQVFDPYKINIATGELEQLYENTDITNPIMGYEFDKDGNLRGFARLK
DGINSEFYYAVEPGDYKLMKTTKWDDTFSIISFDYASENEHDAYMVSNLN
SDKTEIYKYDLAKNEVVEKLFSNKNYDVSGASISRNRNWELDYFSYEGEK
DEIIPVSQYYKKLHKKLEKEFPGYNFYLSDRTDDESQYLIYVTSDKLYGK
YYSYDVTKDEIKLLFDLMPQLKENDMSEMRPISFKSRDGIQLHGYITLPK
EAVKGQKVPVIVNPHGGPQGIRDSWGFNPEAQLFASRGYATLHVNFRISG
GYGKEFLRSGFKEIGRKAMDDVEDGLQYVVDKGWVDKEKAAIYGGSHGGY
AVLRGLTKTPDLYACGVDYVGVSNLFTFMETIPAYWAPYLPILKAVWYDA
EVPEEKEIMTEVSPAFHIDKIKKPLFVVQGANDPRVNIDESDQIVKSLRD
KGVDVPYMVKYDEGHGFAKEENRMDLYTAMMGFFAEQLK
9flao-q5vk61: Flavobacterium columnare prolyl oligopeptidase, 1 reference(s)Flavobacterium columnare Show
MDLRDNGGGSKMKKLALLSVTLMSINSGIAQNTMTPDLLWKLGRVTPLGV
SKDGKNIIYKVATPSIEENKSISKFYTIPITGGNANEIKEYTELIKNKNI
SPDGMYLLSDKEVKITPVLGKDFYPELSLSEAQVYDGLDYRHWDTWRDGT
YNHVFFGGVPAPNVRLAPPIDIMEGEPYDAPQKPFGGDEDYIWSPDSKNI
IYVCKKKTGTAYATSTNTNLYQYNIETKQTVNLTPNNLGYDTHPDFSPNG
DLTWLQMKQDGYEADKNDIIVKHKGIEINLTANWDGTVESFKWSKDGKKV
YFIAPIDGTKQLFEVNFPGLTKIAIGVKQITNGDFDVTQIIDSTPDQILL
MRNDISHASEIYSYHLKNKSWNQITHVNTEIYNNLNLCKTERRYVTTTDG
KKMLVWVILPPNFDSTKKYPTLLYCQGGPQSALTQYYSFRWNFQTIASQG
YIVVAPNRRGMPGHGVKWNEQISKDWGGQVMDDYLSAIDDIAKESYVDQT
RLGAVGASYGGYSVFYLAGIHNNRFKTFISHCGIFNTQSMYGTTEEVFFT
NWDSGGPYWEKNNIVAQKTYTDFNPIHLINNWNTPILIIQGGKDYRVPLG
QGQEAFQAAQLKGIKSRFLHFPEENHWALKPQNALVWQREFFKWLKETL
9gamm-b8kkz4: gamma proteobacterium NOR5-3 Peptidase S9, prolyl oligopeptidase active site domain proteingamma proteobacterium NOR5-3 Show
MLRFALLLGIFVSSAAVSDIRDEQFSIASILSSPFPTEIVAAPDTPGLAF
VLNDRGVRNIWYAGGPGDSARQITAFTDDDGINVSDLKFTADGKRLVFIR
GGSPNAAGELPNPASLTRGGEHAVYVIAVDGGEARKLDNGSGPSVHPSGG
QIAYVNERTVWSIALDDPEAKPEALFQARGSIGSLAWSPDGSRLLFRSNR
GTHSYIGVWTPDDGQGEIVWLSPSVDRDLSPTWSPDGRQLAFLRLPSPAS
DHFPFEPIREDLPWSIRVADPDTGTSVEVWRADKGHGSVHRGIEGGQQLF
WSADDRLLFFWEKNGWNQLYSVAAKGGQPKHLTPGEFEIEYAALTSDRRS
LVYASNQDDIHRRHLWQVDTGGGQPRELTSGDGIEWAPAPLADGGIAFLR
SGATTPARAAVISRKGKIQGLATDTLPAGFPDDLVTPIAVEITATDGKQA
PAQLFLPEGLEPGEKVPVAIFLHGGSRRQMLLGWHMRGYYHNAYSLSQYF
ASRGIIALALNYRSGIGYGMAFREALDYGATGNSEFRDVIGAGLFLRNHP
NVDQDKITIWGGSYGGYLTAHALAQASEMFSAGVDIHGVHDWNDGIRIFV
PGYNKNDFPEESAIADRSSPFHYIDGWRSPVLLIHGDDDRNVFFSQTTRL
ARKLREREVRVEQLVFPDEVHGFLLHRNWLKAYERTAEFLIGEMEN
9gamm-q2c6w5: Photobacterium sp. SKA34 acylamino-acid-releasing enzymePhotobacterium sp. SKA34 Show
MKLIQTILLSSALLLLITGCIRPKEATHQSLTTQQLPILLDFKDLTTATN
GTHSYQISPDGEKLAWLKDSFDNNGNPYTALHFKNLKTGEKGKFNYWVSF
FEWMPDSRNLIYMPHFDDMKSKIFFLDTKFPTRQLTPFYDKDNQIYVVDK
LRNDPENIIVRHNGGDAKIFNLYRLNIKTKKETLLFKVDKELTIDGFIID
DRVKGGSIFAYIKDKRKIYKFGTDKLLFDAGKNGEVAHAMLNHSNNTLTI
LANNNSDKTQLIKLDLATNAINTLYSNDTVDVDKYYYDNNHAPALAASYP
DYQEIITFNPNYKKLASNFYQKGKSGIVIFSTDSKNEKFTLSQYNEYGYN
IYLYDATNDKKELLSQSKSHHYTQFLASQKPIQFTSRDGLTLNGYITLPN
GIKANNLPTVLLVHGGPHLRDYWGFNTEAQLLANRGYAVIQVNFRGSMGY
GYAFTSSGYGEFSKAMHNDLIDGVNWAVEQGITDPNNVAIMGASYGGYAT
LVGMTLTPDKFACGIDIFGMSDLELMVNNFPEPWKRHEDIWVNYIGDFND
PDMKQQRAQQSPINFVNNMNAPLLVIQGDSDAVVIPEQSRRFVEAAKKAG
KNVQYWEMNNVGHHYGTPTQTRKLARKVDNFLSQCIGGRSAG
9gamm-q2wwl5: Shewanella sp. W3-18-1 and Shewanella baltica OS155 peptidase, putative precursor (fragment)Shewanella baltica OS155 Show
MDITMKIAPLLIALSATGLAYSVQAAEPTPFSVQQLIKLNKMHSTTVSHD
GTKLVYGLKTVNEKGEASSDLYLLDLTQANAKPLQLTSAAGTEHDVSFAN
DDKSIYFLASRNGSSQLFQLPLTGGEAVQVSDLPLDIDSYKLSNDGKQIV
LSMRVFPECKDLACSKDKFTAESERKSTGREYKQLMVRHWDTWEDHARNH
LFVGALNGEKLTKVVDITQGLDTETPPKPFSGMEEVTFTPDGKYVVYSAK
APSKDQAWTTNYDLWQVPVTGGTATNLTKDNLAWDAQPTFSSDGRYMAYL
AMKKPGFEADRYGIMLRDTNTGQSKEVAPLWDRSPSSLMFGPDNRTLYVT
AQDMGQVSIFQINTQFGDVQSIYSDGTNSLIAVTNDQLIFDSKTLVEPGD
LYSITTDGQGLKRLTEVNKDKLAKIKFGEFQQFSFKGWNNEDVYGYWIKP
ANYQEGKKYPIAYLVHGGPQGSFGNSFSGRWNAQLWAGAGYGVVMVDFHG
STGYGQAFTDSISQDWGGKPLEDLQKGLTAVSQQQKWLDPQNACALGGSY
GGYMMNWIQGNWNDGFKCLVNHAGLFDMRSMYYVTEEMWFPEYEFGGTYS
DNKALYEKFNPVNYVENWKTPMLVIHGEKDFRVPYGQGLASFSYMQRKGI
PSELLI
9gamm-q2x3k6: Shewanella sp. W3-18-1 and Shewanella baltica OS155 peptidase, putative precursorShewanella baltica OS155 Show
MKKAGILLLCLLMPFGSALAEQGKPLSVELLWQLKRIGSPVVSPSGEHII
APVTEYDLKEDKGSTQLWRFDGEGKNNRAITAKGLKVREPVFSPDGKTLA
FVSERNEDDAGQIYLLPMDGPGEAQRLTDIPTGVNGIKWVGKHLYFISNI
FPNQKWDEMKTQLKTDKDNKVSARQWNALPYAQFDHWLDERRQAHVFRIP
ALGGEVEAVTQPLGYELPRSSQSSSSYDISPNERLIAFSAYGSDNRVDPK
LDIFLATIGSGKAENITPENQAADVNPNFSPNGKTLAFTRQKIPGFYADT
ARLMLLDIDSRKLNTLTPEWDRSVSQFNWTPDSKGFYAAIDDAATSRIYH
IDAKNGKVKAITEATDFGQPAIGKDGELIATNESFLHPARLVSINPRNGK
TVRLENFNDDILKDVDLGTYESVTYKGYQNQDIQMWVHYPPGFDRSKKYP
LFMLVHGGPHNAISDGFHYRWNAQTFASWGYVTAWPNFHGSSGFGQDFAD
AINPDWKNKSLEDVLKAADWFKQQSWIDSDRMVAGGASYGGYLTSIILGQ
PHPFKALLIHAAVYDMYSQMAADFAVHSTRFGNYWDNPELYKAISPHYFA
ANFNTPTLVSHGQLDYRVPVGQGFELFRTLQTRNVESRMIYFPDENHWVM
KPNNSIYWYNQVKDWMTHYAKPGGQ
9gamm-q3nx12: Shewanella denitrificans OS217 region:immunoglobulin/major histocompatibility complex precursorShewanella denitrificans OS217 Show
MKKTSLLLALMTAGLCSSVQAAAPTAFNVQQLVNLNKLHSAAVSNDGTKL
VYGVKIKDANNEASSDLYLLDLSDKNAKPMQLTSAAGTESDVTFAPDGKS
IYFMASRSGSSQIYKLALNGGEAIQVTDLPLDVNGYKLSQDGKQVVMTLR
VFPECKDLQCSKDKFQAEKDKKTTGREYKQLMVRHWDTWEDHARNHLFVA
PLNGNKITTAINVTQGRDTETPPKPFSGMEEVTFTPDGQHIVYSAKAPST
DQAWTTNYDLWQVSVKGGETTNLTPSNAAWDAQPVFSADGRYLAYLAMSK
PGFEADRYKIMLRDNATGDEREVAPLWDRSPSSINFSSDGRTLYVTAQDV
GQVSIFEVNTQFGDVRPIYNQGSSHLVAVTSKGIIFDNTSLTEPGDLYKI
NLEGEHLTRLTEVNKDKLANIKFGEYQQFNFKGWNDETVHGYWIKPTNFE
EGKQYPIAYLVHGGPQGSFGNSFSGRWNAQLWAGAGYGVVMVDFHGSTGY
GQAFTDSISKDWGGKPLEDLQKGLAAVAEQQPWLDATNACALGGSYGGYM
MNWIQGHWNTGFKCLVNHAGLFDMRSMYHVTEELWFPEYDFGGPYSDNKA
LYEKFNPVNYVENWKTPMLIIHGEKDFRVPYGQGLAAFSYMQRKGIPSEL
LMFPDENHWILNQDNLQQWYNNVLGWMDRWTAK
9gamm-q3nzs7: Shewanella denitrificans OS217 peptidase s9, prolyl oligopeptidase active site region precursorShewanella denitrificans OS217 Show
MKALILGAIMALCCQNAAQANSLLQAERFSRGAEFSNVKLSPSGEYLSAI
TNHEGKDTLIILNTSNKKLLNALNFPGNAQVGDYEWANNERIVLQKVYLK
GWTNVPQYYGELMAVNADGSQVQYLFGYNSNVQQTGSHIKKNTPIRATAF
ILDPLPDNKQFMLVNAIPWDGKRSLDFSLIQSVYRVDLYNGKRTKVMKAP
VGYARFMTDHTGEVRFSIGENKNNNTKVFYRADGKWQDSKTLNLGLSDLT
PISFADKPNSIYAAGREMGQTLGVYKIDLETGDKQKILQDPKLDPTDYWV
NQQTKQLYSVEYQDSYPTYAFVDNKDKHSVQLKQLIASFPGYQVHIVSET
RDSKQQLIRTFNDRNPGDYYLFDTEKVKLSYLFSEKKWLDPELMAEVKPI
SFTNRDGIEITGYLTLPHGLEAKNLPLVVNPHGGPHGVRDVWGFEPQNQL
FASQGYAVLQVNFRGSGGFGEAFEKAGHQKWGLDIQHDIIDATHHVIEQG
FANKNRMCIVGSSFGGYSALQSAIIEPDMFKCAIGVAGVYDLPLMFDEGD
ISERSAGLSFLKQVLGQDKTILKAMSPSYNTDKLKAKLLLVHGGDDERAP
IEQLESLEEALKARNYPYEKMIMDDEGHGFYNDDHRAKYYQKMLSFLDAN
LNL
9gamm-q3qel0: Shewanella amazonensis SB2B peptidase s9, prolyl oligopeptidase active site region precursorShewanella amazonensis SB2B Show
MKVMMTIVLSLIWMWVSPTAHAYTQLTKDDFISDPLIYDAEFSPDGRYLA
FIRQAGKSRDVVIRDFSQEGAPITGILQDEFIRADSISWANNTRVIVNLM
VPYERISKLKKKAEKDPEFDLDEYDYFRRSISMDVHCQDRVVLLNHKKYS
RKNLNLSRVSNLLVDDEQHILMPAWGHKGLEIMKVNVYTGKGEVVLEGGR
RTYNILTDKQGQPTFRLDYYYYSRSVQVYEYTQEGEWVPIDRIYFEQNED
GEFDFEGLVGIGKEGELIYRKRNETSGYYEIVKYKKGSKEKQVVASLPEE
DIYSPMFDAFTGEYLGYQVQRDLIRNVYLDKSYQAHYDKVAEDIGHSNFS
FWASSTSKNRVVVKSSGADHLGKFYVYDYKTQALTWLGDVHNQLVPENLG
LPAKVNYSTRDGQKLRMYLLFPPNYDDTKAYPMVVLPHGGPQSRDSASFD
FFAQFIATRGYIVIQPNFRGSTGYGLEFEKAGYKQWGQRMQDDVSDAVTY
MTQNGYADKSRVCIVGASYGGYAALMGAIKTPELYRCSISINGVTHLKDQ
IAFDVDSAEINEDRIEEILYERIGHPIRDAKMLDDNSPALLASKVSLPLL
IIAGDSDQIVPYTQAEVMVEALAKSKKDFKFVELTDTGHNPFILKDSAAK
VYQEVEQFLKTHLGE
9gamm-q3qgm4: Shewanella amazonensis SB2B peptidase s9, prolyl oligopeptidase active site region precursorShewanella amazonensis SB2B Show
MKLHRLFGALALCLCASANAATPEQVFARGSQFSQVRLSPGGDYLSAITK
HEGKNKLLILDTETLKLKHAVFFPANAQVGDYDWVSNERIVLAKEYLKGW
SDHPLYYGELFAVNADGSRATYLFGYNGGEQQTGSNLKKNTPIRATASVL
DPLPDDDKYLLVKALPWSGVDWQEGLADVYKVDVYRGTRKKVTRAPIGYA
SFLTDHEGEVRFAAGRDSNNDLKVFFRDDGDWQTSDKLDLGLGDFIPLSF
VGDNSSIYAAGTESGQTMGVYRINLKDGSKTRIIQDPRVDPANYWINGQT
KQLYAVEFADGYPTYAFVDANDERSQLLKTLLASLPGHQVQIVSEDRKGE
LLVVAASNDRNPGDYYLYNRKTNKLRYLVSVNDALDPDKMAEVKPFDFTA
RDGTKVQAFLTLPFGVDAKNLPLVVNPHGGPHGPRDYWGFDPQNQLLASQ
GIAVLQVNFRGSGGYGNAFEEAGYGKWGREIQYDIIDATKKVIADGTVDK
DRICIVGGSFGGYSALQSSALAPDLFKCAIGFAGVYDLELMFEEGDVQKR
DAGMAYLKRVLTQDKALLQSMSPTHNVDKLKAAILLVHGGEDERAPIEQY
EAMANALKKHNYPFQSLVMDDEGHGFYNEAHRAKYYGEMLGFLKTHLKF
9gamm-q3qh90: Shewanella amazonensis SB2B serine active site precursorShewanella amazonensis SB2B Show
MNKIHLITALCLLPLLSHAADDTSTTATNTAASTSERLLSVERLWQLERV
GSPVVSPNGQYIIAPVTRFDVKEDKGYTRLWLFDRDGKKQRPITAEGLGA
SEPVFSPDSSTLAFVSKRDKDDAGQIYLLPMTGPGEAQRLTEVPTGVYGI
KWVGKHLYFIANVWPQKSWDEMAEQIKADKDKKLSARQWNALPYSQFDHW
LDEDRQAHVFRIAASGGAVEAITQPLGRELPRSSQSSADYDIDANEQYIA
FTSNGWDNQVDPNIDLFLARIGGNQADNLTPDNKAPDDSPSFSPDGDTLA
FSRQHIQGFYADTARLMLYDMDSKKLQSLTDGWDRSLGSFVWSKDGKSLF
SNIDDAATQRLYQIDAKTGKPRAITKATSFGAPAVADKSTLVATNDSFLY
PSRLVTVDVKSGKTTRLDKFNDDLLSQTDLGHYESVTYKGADGKDIQMWI
HYPPGFDKSKKYPLFLLIHGGPHNAIGDSFSYRWNAQTFSSWGYVTAWPN
FHGSSGFGQEFADAINPDWRTKPLADIQAATQYFEAQPWIDTERMVAGGA
SYGGYLTSVLLGTEHPFKALLIHAAVYNMYSQMAADFAVHSTRFGGFWEN
PEIYKTISPHYHADKFKTPTLVIHGQLDYRVPVGQGFELFRTLQTKGIES
RMIYFPDENHWILKPNNSIYWYNEVKDWMTRFAEPGAR
9gamm-q3qil6: Shewanella amazonensis SB2B peptidase s9, prolyl oligopeptidase active site region precursorShewanella amazonensis SB2B Show
MKKTLLTLSLTAVALAGCQSPQSNQATDTAATANVTNHQNAATAKQPYAK
PLLLAHPNYDAKTFFDTTSYTGSSISADGSAVLVGSDESGIYNLYRLSLL
DGSKTQLTNFEDSTFPVRWFPGDDRVLLSKDKGGNELNHLYVRELDGSVK
DMTPGENTRASFAGFSGDGKAFFVQTNERNPKFMDLYRYDASTYERTLVF
QNDEGYSLGDIDRSGRFVALNKSVSNKDIDIYLLDLRSRALKPVMVSEPG
LEAAEEVFSFAHNGQTLYYGSDAKSEFNEVWAYDIASGKRQPIASHDWDV
SYYGFSESGRYQAMAVNADASTKVTITDTQTGKALALPPLPPGDFRGVSF
SKDDKTMVFYLNSDISPSELYVWQIGEPSVKRLTKALSPAMDSANLVPSE
VVRFKSFDGLEIPGLLYRPKLAHAASPSPAVIYVHGGPGGQSRSGYNPAI
QHLVNHGYVVFAINNRGSSGYGKTFFHLDDKNHGDGDLKDMVWGKKYLQS
LDWVDKERIGIMGGSYGGYMVAAALAFTPEEFKVGIDIFGVTNWVRTLNS
IPPWWESFRKSLYDEMGDPATDAERHKAISPLFHAENIVRPLMVIQGAND
PRVLQVESDELVEKVRANGVPVEYVLFDDEGHGFTKKANRITASEAYLKF
LDTYLKP
9gamm-q33tx5: Shewanella sp. PV-4 region:immunoglobulin/major histocompatibility complex precursorShewanella sp. PV-4 Show
MTITMKKTAIILALATAGLVSGAHAAAPEPFKVQHLVKMNKLHSSALSND
GTKIVYAVKKFDDKGEAQSDLYLQSLIDGKVKRLTSAKGTEHSVAFSADD
KKIYFLAARDGSSQLYELALDGGEAVKISNLPLDVEGFKLSQDGAQVVMN
MRVYPECDTLQCTADKREQEAERKSTGREYKQLMVRHWDTWGDHSRSHLF
VAKLDGKMIDTAVDVTKGLDTETPPLPFSGMEEVTFTPDGKYVVYSAKAP
SKSQAWETNYDLWQVSVLGGEAKNLTESNKAWDAQPTFSADGRYLAYLAM
SKPGFEADRYRVMLRDTVTGQEKEVAPLWDRSPSSLTFGADNRTLYVTAQ
DLGQVSIFEVNTQFGDVKTLHNDGSNSILGVTGDKIVFNHKSLVEPGDLY
TMSLDGQNVNRLTEVNKDNLAKIKFGEFEQFSFKGWNNEEVYGYWIKPAN
YKQGKKYPVAFLVHGGPQGSFGNSFSSRWNAQLWAGAGYGVVMIDFHGST
GYGQAFTDSISKDWGGKPLEDLQKGLAAVTAQQKWLDGDRACALGGSYGG
YMMNWIQGNWNDGFKCLVNHAGLFDMRSMYYVTEELWFPEYEFGGTYQDN
KELFEKFNPVNYVDNWQTPMLVIHGEKDFRVPYGQGLAAFSFMQRKGIPS
ELLIYPDENHWILNPDNLEQWYANVLGWMDRWTKK
9gamm-q33um5: Shewanella sp. PV-4 hydrolase precursorShewanella sp. PV-4 Show
MKLIQSFSLACLCLISSQVTASNKDITELFSRSAEFSNVQISPDGDYLSA
ITSHEGKHMLMILDAKTKKPTNVVRFPDNAQVGQYVWVNNERVVLAKEYL
KGWSDHPIYYGELMAVNADGSKPTYLFGYKGGEQQTGSRIKKNTAIQATA
YILDPMPEDDRYMLIQALPWGSGSANTVENLQQVYRVDVYKGTRRKIATS
PISYARFLPDHDGEVRFVSGTRDYVSSQLYYRKDDEWVDTDKLNLNLDDI
TPIAFGDDENSVYVLGSENGKPKGVYLVDIKSGKKQLISQDKVVDPSNVW
INRVNKQLYAVEYENGYPTYEFVDNDEKLATTLKQLLTALPGHQVHLVSQ
TNDMSKLIIKAFNDRNPGDYYIFDATSKKLEYLVSQKKWLDPDKMAEMKP
ISFTARDGRVISGYLTLPYGKEAKNLPLVVNPHGGPHGPRDWWGFDDQNQ
LIASQGAAVLQVNFRGSGGYGKEFEHAGHQKWGTEIQYDIIDATKYVIEK
GFVDKERICIVGGSFGGYSALQSPILAPDLFKCAIGFAGVYDLELMFNEG
DVQGRRAGERYLKQVLGENEAMLEQMSPSKNVDKLKVNLLLVHGGEDERA
PIEQLEALEEGLKKHNYPYEKLVMDDEGHGFYNDEHRAKYYRQMMSFLKD
NLKL
9gamm-q36hn7: Shewanella sp. ANA-3 putative peptidase precursorShewanella sp. ANA-3 Show
MQKFPFTSQLCSAAIAAALLLTGCTTADVRNEQPQVAATQQTEAPLIPIE
NFFNEQSIRHLKMSDDGKWLAFVKEYQGASNIYLMADKSDLASATPLTTS
VEPIRAFEWSAKGNDLFFMKDKGGNENTQIYKLSFEEHAGKITAKEQRLT
HKDDVQYSVLEQVKDNPDLLVVQANHDDSSRMDIYLLNINDGKLTPILKN
ELSFTQVKFNKQGQPVIASSSNLDNTNALYVQIDGNWRKIIQSAKGESID
ILKVNDDKKLAYISANIGDRDKQELLKVDLMTGKYETIHRDPDNEADVFA
VQFSDAGEPLAVGYYGGRLRVYPLDAEFTRHWDVINRHFNQDVEITIGEM
NEKTNLWQIHVASDRAAGADYQYNAATGDIHLLVDIPASIPADQLSPRQS
IVYTARDGVKIQAYLTLPKGKQTQLPTIILPHGGPWARDFWTLDSGYFHA
IAQFYANRGYAVLQPNFRASTGFGKKFLNLGNNNWGIGSMQHDLTDGANY
LVEQGIADKQRLGIFGASYGGYAALSGATFTPDLYQAVIAYVGPSSLVTL
MNSFPDYWRPYLGQWFESVGDPQIAEQKQDMEKRSPINYVDNIKAPLMLI
QGANDPRVTQIESDNIAKKMYQKSLPVKYVLAKDEGHGFSKRANKLASIV
ATEQFFAEHLGGRVDTNVNPDILKHLDSLNVDISKL
9micc-q4nkj0: Arthrobacter sp. FB24 peptidase s9, prolyl oligopeptidase active site regionArthrobacter sp. FB24 Show
MASEDSAILSEQPATPFHDIDHYLAIPRVSGLALSPDGQRLVTTVSTLNG
KGTEYVTALWELDPAGEKHARRITRSAKGEAGAAFAATGDLYFTSARPDP
DSPDDDPVSALWQLPADGGEARVVLSRAGGISQVITAKDSGATFVTASVL
AGSADEEADEARRKSRKDNKVSAILHSGYPVRYWDADLGPDQPRVFAVEP
GEDKDPGKPATVDAAAPLKLRNLTPEAAGMLRNADSVVSPDGRTIYTSFD
KPLAKADSRSVLVAIDVATATHKILLDREGMSYFAGPVSPDSRTLVVLSE
SDTTPRQAPRVKLHLLDVSAPGEPEDNLRPLAHEWDRWAIKAAWLPDGAA
LLVTADDDGASPVFRITPAAAGAGAGEDQVTRVTLDAAAYADVVVSPDGL
SAYALRSSYEFPPEAVRIDLASGQVTRLQAPAERPRIQGSLERIEATAAD
GARIPAYLALPEGASAQNQAPLLLWIHGGPLGSWNAWTWRWNPWLLVARG
YAVLLPDPALSTGYGQSYIQRGWGEWGKAPFTDLMTITDAVVQRPDIDAS
RTAAMGGSFGGYMANWVAGQTDRFNAIVTHASLWALDQFGPTTDASQYWL
KEMTAEMALANSPHLHVEKISTPMLVIHGDKDYRVPIGEGLRLWYELLSK
SQLAADDNGRTPHRFLYYPDENHWILQPQHAKVWYGVVEHFLARNVLDQD
APLPAELGL
9sphn-q1na32: Sphingomonas sp. SKA58 prolyl oligopeptidase family proteinSphingomonas sp. SKA58 Show
MRGIAKAACIALWLAGSAATALAQGQPDALAKAFGARETISSASLSPDGR
TIALIASGPGRTSRAYVLEAREGADIKVVASTSGRPEYLQRCDWVSADRL
ACQIFGEQRYGDDVYGFSNVFAVSANGADTKLLSQRRGANALSYDFRGGD
VIDLLPGDEDAVLMTRSYVPEATAGSLIEKKLEGLGVDRIDTRSGSAKRI
ESPDKLAVDYVSDGQGQVRIMALQENRTSGYAKGTYKFLYRPVGKSGWSN
LSLYDTRDNSGFYPVAVDPTKNVAYGFEKMNGRDALVTVALDPGRAKTVI
FSRPDVDVSALIRVGRDRRVVGASYVTDHRQAVYFDEQAKALVSSLGKAL
GGKAINISDMSSDGNRVLIWAGSDVDPGQYYLFDRAARKLSPVMPDRPEL
AGRTLAVMQSIQYQAGDGTMIPAYLTLPPGKETAKGLPAIVLPHGGPEAR
DEWGFDWMVQYYAARGFAVLQPQFRGSAGFGEAWLMRNGYRSWRTAISDV
VDAGRWLVAQGIANPDKLTIAGWSYGGYAALQAQTVDPALFKAVVAIAPV
TDFADRMRRSQYSADYLLQQQRMGTGPEAAEASPSNHAAAFRAPVLMFHG
TDDSNVDISQARIMQAKLQGAGKRSQLITYDGLTHSLTDSDARADMLQRS
ADFLMAAGK
9sphn-q1nfy7: Sphingomonas sp. SKA58 peptidase s9, prolyl oligopeptidase active site regionSphingomonas sp. SKA58 Show
MKTLLLAGIGAMALACAPALARPFTPADMVSLDRIGAPAVSPDGKWLAYQ
LRSTDLAANRGRTDLYLLAIDRPGQTPRKIASVADKNEASPVFSPDGSAL
YFQSDASGDDQLWRVALSGGDPVQISKAPGGISGFLLSPDGMKVALWADR
PVGAKTLDDVKPTAPADAGSGRVYEQLFVRHWDTWSDGQRSQIFVMPIAG
GPAVSVMGGLVGDSPSKPFGGAEEIAWSRDGKTLFFALREAGRIEPLSTN
LDIFSTPADGSAAPTNLTDANDATDTMPAVSPDGQWLAYAAMKRPGYEAD
RLVLTLRNIATGETRALTEGWDRSVGSIAWAADGKSLLVTANDVLDNPVF
RVDAALGKVTRLTGKGHAGSVIPLPQGGFVYALDSIQSPADFWKMPARGK
PVRLTRVNADRLAGVDDVSVERYSFKGANGDTVWGQIVKPKGATGKLPVA
FLVHGGPQGSFSDSWSYRWNPKAFAAHGYAAVIVDFHGSTGYGQAFTDSI
NKDWGGKPLEDLKLGLAAAAAQDAQVDAGNACALGASYGGYMMNWIAGQW
PDGFKCLVQHDGVFDARAMAYETEELWFDEWEHGGPYFEVPQEFEKWNPV
NHVAQWKMPMLVVTGEKDFRIPYTQGLAAFTALQRRDIPSKLLVFPDENH
WVLKPKNSLQWYGEALGWLDKWTAK
9sphn-q2n6l4: Erythrobacter litoralis HTCC2594 prolyl oligopeptidase family proteinErythrobacter litoralis HTCC2594 Show
METAEPMTARDLVTMPRLGAPTVTGDGRYAVFAITVTDDETLKRTSELHL
RDLTDLDAATTKLDLLGSARSAAFGPDNWLYFLSDREGAGTGSKAGSVQV
WRASLEADGSVKGPLPVTDFGTDVDGFSLSPAGDAIAVWAEIARDCPRFG
CDGDGTAHLPSPGNGRLYDGADGFYRHWDTWETPGTFSRVFVFGLENGKT
VGDGKALDGPPGDGASITGDTPTKPFGGGEDIAWAADGSAIYFVARKADG
DEPTSTNLDIYRSDLDGGAPENLTAGNLATDTSPVPSPDGRYLAYLAMAR
PGYESDKLTVMLRDLASGESRALTPDYDRSFHSLAWTPDSRWLVATAQDV
LDTPAFRIDPQTGAVEKLDLMAGNEAHIANVMPLPGERLLFARDSIGSPS
HLFLSDGWQQAKPLVLVGGPEVGAMASVQTTRFSFAGAGGDTVWGQITKL
EGADGPMPAILYIHGGPQGSFNDGWSSRWNPRVLASQGYAVISVDFHGST
GYGQAFTDSINRDWGGKPLEDLQKGLAAALARDPQIDGNRACAMGASYGG
YMVNWIAGNWPDRFKCLVQHDGLFDMRSFYYTTEELWFPRWDFGGSYAEA
VETYERWNPVNYVNNWQTPMLVVAGERDFRVPYTQGLASFTALQERDIPS
QLLVFPDENHWVLGGKNSLQWHETVFAWLDRWLKEDGEAGE
9sphn-q2nas7: Erythrobacter litoralis HTCC2594 prolyl oligopeptidase family proteinErythrobacter litoralis HTCC2594 Show
MKYCSSLAALAAAAFAAPLAAQTLAEDASAFGARQSVENLSISPSGDRLL
YIQPGAQSDETIYVVDLANGGAPTPIITMNEAQARLNWCQWATEERIVCE
IFGMQDSGGVLLNFTRVMAISADGSDTEMLTPSSSYKTMGVLQDGGDVLA
LDVEGQDSKILMTKRYIKERCEKTRLCNDK