Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Prolyl_oligopeptidase_S9

Prolyl_oligopeptidase_S9


Genes:Proteins in Prolyl_oligopeptidase_S9 (189)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
xanca-XCC1105: Xanthomonas campestris, Xanthomonas axonopodis, Xanthomonas oryzae, X. perforans, X. vesicatoria, X. fuscans, X. gardneri alanyl dipeptidyl peptidase, 9 reference(s)Xanthomonas campestris Show
MMAARPMPPRRHARQPYVFDSTRLGILVAALTRAIPCTRRGPRGNAGRRK
RKSLRVRRSNAYHRRFAVAGTPMKLRTAVLPLCLLTALPMLAAARGFDVR
DMVALDRVSSPTLTPDGSVVVFAKRQAKTANGKAATSLWMRNLRTRDLAP
PKRLTPEGWNVNSPALSPDGKKVYFLSSKSGTQQLYAQPLAGGIPQQLTA
FAVDLDSYKLSPDGKRIAFSAGVFQDCGSDLGCTKKKLADLKNAKASGVV
YDQLFVRHWDTWNDGRRNTLFVAELPAAGAKAVAGASAISATLAGDAPSK
PFGGNDDYAWSPDGASVVASVRIPQPHGPGAGKTAAQGKATGNDEAWQTN
FDLYRLDAAGKSAPVNLTAANPAWDAGPVFSADGKTLYYRAMKRPGFEAD
RFGLMAMDLASGKTREIAPKWDRSAGEIVLSDDGSSLYTSADDLGEHPLF
KIDIASGDATKVVGEGSVHAPVLAGTTLAFTRNSLKSGDQIVVSDVQGQG
LRAITQSAGELLPDVQFGDYEQFQFKGWNNDTVHGYVVKPYNYEEGKTYP
VAFLIHGGPQGSFGNGWSNRWNPQTYAGQGYAVVMIDFHGSTGYGQEFTD
AISQHWGDRPLEDLQKGWAAAQKQYGFLNGDKACALGASYGGYMVYWMAG
NWNQPWKCLVDHDGVFDNRTMGYATEELWFSEWENGGTPWQNPAGYEKFN
PVLHVDKWKVPMLVIHGQQDFRIPVEQGLAAFTALQRKGIDSKFLYFPDE
NHWVLKPDNSVLWHDTVNAWLKQHIGQ
spops-e1vfe0: Sporosarcina psychrophila (Bacillus psychrophilus). Amino acyl peptidase, 5 reference(s), 1 structure(s).e.g. 5L8SSporosarcina psychrophila Show
MINFPKPTVEQFFRTYTITNFAVSSDEKRLVFNANLNGKMNLWAMDLPDT
YPYLFAHRDESCNFIKFDPENRYVLAGFDKDGDENYQIYAIPNEGGLPHP
LITGDASEKYYFSHLSADGKCVYYETSKENPSFLNTRIRNLETGEDRLLN
VGEVSTTELAAVSENEESFVYLRAFANTYIVGFVKMGEETFNITPDPEKV
HVAMEPVFTDNETIYFATDYDSDEMYLAKFDLTSKEFSKVLAFDGESIQS
VKWDKDNKAFYLITVKGVTDILYRYDVATDKVEECSLPVDIIEQIQVAKS
GNLYILGRSATVPHNVYQSSNGVEWKQLTNNRVLGLSPEDMVEPDIVSYT
SFDGMEIEALLFKAKPENDNGYTIFWPHGGPQSAERKMFRSMFQCFINRG
YTIFAPNFRGSTGYGSAFTKLVELDWGEGPRLDCIAGIEWLFESGFTDRN
KLFLVGGSYGGYMALLLHGRHSDYFRAVVDIFGPSDLFTFINSVPPHWKP
IMERWLGDPERDKERFIKDSPVTYLDGMVKPMLVIQGAKDPRVVKEESDQ
IVAKLKEKGRDVEYLVLEDEGHGFSKKENEIKVYSLMLAFLEKHQA
strpn-SP1343: Streptococcus pneumoniae, prolyl oligopeptidase family protein (EC 3.4.21.83), 5 reference(s)Streptococcus pneumoniae Show
MNQSNEIFLNTIQEKTHYKRSISSSFQELKKWNSLIFRRGRYWYQFDNWS
IPNTGVIKEWYVEDNDWIPKVSSSSLDNSNSLKIVFDVEKYTLPDDSILQ
DVRISSDESYIVLVVSSLRTTNLIGIKKYTMEELFIIEDISVESSFYLGK
FGVMYTRSKEYGRPSKLFYKSFDSFTEEELFEENECSFRLKIVHIDSNNC
FVKSVDFQKGRIFLYSFDRTGFVRHSYTETVAPTPRDIALFSTEKAQYFL
GLSSTEEKKDQLILRETSSGDRVSITIPYQDRARRVHCIGRYILLDCSNA
ANSVFYLATFKNNSLRELSVNKITFDEKTTLYENSFSDRVLLFLERRTFY
EKILSFDLIENTLKTEFERPIIKSNNTKYFSKVIWTKKDSYDVSIPISLF
WKSEDTDELPRRKKCILSVYGAYGKNDNSDLDEIMLSIIDAGFIYAIVHV
RGGGYLGGEWYRSGKALNKWNSIRDFIEGVNYLRENDVIDSKRLGLITSS
AGGIIAGAVLNEEKNLLQSILLFSPFINPYDTLQNPNDPLSKTEIAEWGD
IRDPEVKAYIKSYSPMQNIEKARDSNTVIVNILGEKDPYINNNEVIEWSK
KLNSIGVKSLLYLNKAAGHGGFTPSDVLLMIDTLNYFFEEVGRNNL
ricco-RC0603: Rickettsia conorii, Rickettsia sibirica, Rickettsia rickettsii, Rickettsia africae, Rickettsia massiliae, Rickettsia peacockii, acylamino-acid-releasing enzyme, 4 reference(s)Rickettsia conorii Show
MSKIFYIIGTILIISVGIFMFQTITDNNQIIPRKVLFGNPDKARVSLTHD
GKYILYVAPKDGVLNIWLAPSDDISKAEAITHDKGRGIWSYAKAYNNKNI
LYTQDFNGDENDRIYSYNIETKETKLLTPAKGVKAQIAGASHKKPNEILI
YLNERNPEYFDIYKLNLDTLEKELIYKNDRFTDYITDENLNLRFGSLLDK
DGAVEYYELKDGEPKLFTKISMEDSFNTSILGFDASGETLYMLEGRNRNT
SALKAITLATGSEEILAEDAKADIGLFTVHPTKQTPQAVSIDYDRVSYKI
LDKDIEDDIKYLQSIDRGDLIINSRTLDDKTWIVAYMADNAPVKYYKYDR
ANKKAEFLFTNRKELEQYNLAKMIPIIIKSRDGLDLVSYITFPNDVKLDK
NNIPDRKVPLILNVHGGPWVRDSWGYNPEHQWLANRGYAVLSINYRGSTG
FGKDFLNAGNLEYAGKMHTDLIDGVNWAIKNNIVDSDKVCIMGGSYGGYA
TLVGLTMTPDVFACGIDVVGMSNLLTHVQSKAPYMTPLLSIYKTRIGPWD
TEEEKEFLRQRSPINFVDNIKKPLFIAQGVHDVRVVQAESEQIVNSMQAK
HIPVVYALYKDEGHGFAKAGNRISYYALAEQFLAKVLKGRAEHIGDDLKN
ANLILNDKEKISGTEAEKIIDTAVGN
agrtu-ATTS: Agrobacterium tumefaciens (strain C58 / ATCC 33970) dipeptidyl peptidase IV, 3 reference(s)Agrobacterium tumefaciens Show
MSAISRHIIDRGDGAAVELFQAQTAFPPKGAILFVHGNQGGLLLGAKEAV
DNGMLLRFSSRLNVTAAAVSQPGFGASEGPTDFCGPTTQQAIIAALGFLQ
KQSLIDPERIILYGNSRGAVASAMVATQMPDLRAVILSSGVYDLKRAYQS
SPRGLQLAIEKEAGLTNTAFLDRSALFHSHKIRAETLLLHGKHDDRAPVD
QAERFANAISEAGLSVDLQTFECGHRIAGELTAPVLRNFLTRILAPAATF
H
aspfc-dpp5: Aspergillus fumigatus (strain CEA10/CBS 144.89/FGSC A1163) (Sartorya fumigata)(and strain Af293) Dipeptidyl-peptidase V, 3 reference(s)Aspergillus fumigatus Show
MGAFRWLSIAAAASTALALTPEQLITAPRRSEAIPDPSGKVAVFSTSQYS
FETHKRTSWWSLLDLKTGQTKVLTNDSSVSEIVWLSDDSILYVNSTNADI
PGGVELWVTQASSFAKGYKAASLPASFSGLKAAKTKSGDIRFVAYGQSYP
NGTAYNEELATAPLSSARIYDSIYVRHWDYWLSTTFNAVFSGTLKKGHGK
NGYSLDGELKNLVSPVKNAESPYPPFGGASDYDLSPDGKWVAFKSKAPEL
PKANFTTSYIYLVPHDASETARPINGPDSPGTPKGIKGDSSSPVFSPNGD
KLAYFQMRDETYESDRRVLYVYSLGSKKTIPSVAGDWDRSPDSVKWTPDG
KTLIVGSEDLGRTRLFSLPANAKDDYKPKNFTDGGSVSAYYFLPDSSLLV
TGSALWTNWNVYTAKPEKGVIKKIASANEIDPELKGLGPSDISEFYFQGN
FTDIHAWVIYPENFDKSKKYPLIFFIHGGPQGNWADGWSTRWNPKAWADQ
GYVVVAPNPTGSTGFGQALTDAIQNNWGGAPYDDLVKCWEYVHENLDYVD
TDHGVAAGASYGGFMINWIQGSPLGRKFKALVSHDGTFVADAKVSTEELW
FMQREFNGTFWDARDNYRRWDPSAPERILQFATPMLVIHSDKDYRLPVAE
GLSLFNVLQERGVPSRFLNFPDENHWVVNPENSLVWHQQALGWINKYSGV
EKSNPNAVSLEDTVVPVVNYN
giain-Q95WU5: Giardia lamblia (Giardia intestinalis) dipeptidyl-aminopeptidase, 3 reference(s)Giardia lamblia Show
MTLSAWIILVTLAMASVLTPEDNVRLRRLTAYVANADASIVLLTYTEYEE
GTNHGNSMLWRINDPLEAEYPFDPDDISLLNAERVCPELVGVGDLQYSTH
NQAFYFTAQGPDGTSQVYSYNHKLETCTQISFLPISVSNLKVSPKGNSVL
FSAEIFVYPNNHASVDDPLNFAHDEFARIQARPYKAFAYEQLYTRHWDED
ILPSQYRHLFAARLERSSEYDDDYVRITVDNSIDLMPRFDGDCPMRPFAD
ASSYTFDSHGRYVAFVTQVGSTAAFYTNDSIWITDLQQFLDAKKPVRDVV
LPLRCATCWNKARDQRPAFSYDGIFLYYASMDEEQSESDLLRLRKQNVSD
LFEYDCDSLFCGPVTGEGVFNLTAGVFDRSIGQFIIPTDSTEDSIYILAE
DHARTNLFRYNEESSTVTRLTYNGTLGSLLYLRHNKIFLATMSSYTRPTD
LVMLDLTVATEFTATRDPSDTMKDDLIKISYLTDLNRQRLRHIDELQEPE
EFYLPSKSFPDQYVHSWYFAPANLRDSHEYPLILYVHGGPESPWANSWSY
RWNPQLIAARGYGVLATNFHGSSSFGEVFQKSVRGNWYSYPLEDIMDAWS
NIYTHADKAYLSREKVCAMGASFGATFMNYMNSHVNNVTCYVTHDGVFDT
MCNALETDELFFPVRELGGFLLDEQVDNQQLYEKWNPARFVENMSAPMLV
IHGQKDYRIQVYHGISLFQALRLRGIKTKLVYFPTQSHWVWQPQESLFWH
TQVFDWLDTYL
porgi-q7mwa7: Porphyromonas gingivalis (Bacteroides gingivalis) prolyl oligopeptidase family protein, 3 reference(s)Porphyromonas gingivalis Show
MTLSRVSEMALSPDGKTAVYAVSFPDVKTNKATRELFTVNLDGSGRKQIT
DTESNEYAPAWMADGKRIAFMSNEGGSMQLWVMNADGTERRQLSNIEGGI
TGFLFSPDEKQVLFTKDIKFGKRTKDIYPDLDKATGRIITDLMYKHWDEW
VETIPHPFIANATDGMITTGKDIMEGEPYEAPMKPWSGIEDFSWSPDGQN
IAYASRKKTGMAYSLSTNSDIYIYNLASGRTHNISEGMMGYDTYPKFSPD
GKSIAWISMERDGYESDLKRLFVADLATGKRTHVNPTFDYNVDMIQWAPD
SKGIYFLACKEAETNLWEITLKTGKIRQITQGQHDYADFSVRNDVMLAKR
HSFELPDDLYRVNLKNGAAQAVTAENKVILDRLTPITCEKRWMKTTDGGN
MLTWVVLPPNFDKNKKYPAILYCQGGPQNTVSQFWSFRWNLRLMAEQGYI
VIAPNRHGVPGFGQKWNEQISGDYGGQNMRDYLTAVDEMKKEPYVDGDRI
GAVGASYGGFSVYWLAGHHDKRFAAFIAHAGIFNLEMQYATTEEMWFANW
DIGGPFWEKDNVVAQRTYATSPHKFVQNWDTPILMIHGELDFRILASQAM
AAFDAAQLRGVPSEMLIYPDENHWVLQPQNALLFHRTFFGWLDRWLKK
triru-DPPV: Trichophyton rubrum tri r4 allergen, Arthroderma benhamiae (strain CBS 112371) (Trichophyton mentagrophytes) (secreted dipeptidylpeptidase v) keratinase, 3 reference(s)Trichophyton rubrum Show
MAAAKWLIASLAFASSGLAFTPEDFISAPRRGEAIPDPKGELAVFHVSKY
NFDKKDRPSGWNLLNLKNGDINVLTTDSDVSEITWLGDGTKVVYINGTDS
VKGGVGIWISDAKNFGNAYKAGSVNGAFSGLKLAKSGDKINFVGYGQSTT
KGDLYNEAAAKEAVSSARIYDSLFVRHWDTYVGTQFNAVFSGTLTKSGDK
YSFDGKLKNLVQPVKYAESPYPPFGGSGDYDLSSDGKTVAFMSKAPELPK
ANLTTSYIFLVPHDGSRVAEPINKRNGPRTPQGIEGASSSPVFSPDGKRI
AYLQMAAKNYESDRRVIHIAEVGTNKPVQRIASNWDRSPEAVKWSSDGRT
LYVTAEDHATGKLFTLPADARDNHKPAVVKHDGSVSSFYFIGSSKSVLIS
GNSLWSNALYQVATPDRPNRKLFYANEHDPELKGLGPNDIEPLWVDGART
KIHSWIVKPTGFDKNKVYPLAFLIHGGPQGSWGDNWSTRWNPRVWADQGY
VVVAPNPTGSTGFGQKLTDDITNDWGGAPYKDLVKIWEHVHDHIKYIDTD
NGIAAGASFGGFMVNWIQGQDLGRKFKALVSHDGTFVGSSKIGTDELFFI
EHDFNGTFFEARQNYDRWDCSKPELVAKWSTPQLVVHNDFDFRLSVAEGV
GLFNVLQEKGVPSRFLNFPDETHWVTKPENSLVWHQQVLGWVNKWSGINK
SNPKSIKLSDCPIEVVDHEAHSYFDY
xanax-XAC0262: Xanthomonas axonopodis, Xanthomonas campestris, Xanthomonas vesicatoria dipeptidyl aminopeptidase, 3 reference(s)Xanthomonas axonopodis Show
MQRLLLVSSMLLALSACSDKPAPAPEKAAAPAPATTAPAAPPALITRDAL
FGNPERANVSISPDGKYLSWVAPLEGVLNVWVAPVDAPDQARAITKDTAR
GIRNYFWTYQPNTLLYLRDNGGDEDFHLFSVNLTDGSSKDLTPFKKTNAE
VYRVSAQHPESIMVGMNDRDAKWHDLYRVDLASGKRTLVQKNTGSLDAYL
LDGGYQLRYATRATDDAGRELLVPDGDGWKSVDRIPFEDVTNTAPEGLTE
DGKTLYMQDSRNRDTAALYAIDTASNTRTLLFENPRADVGATLNDPKTGA
VQAVSTDYLREEWKPLDNGIAADLQKLKSLGGGDASVAARTLDDRIWIVG
YSAAETPLTYYRYDRADGGKLTKLFSARPALEGKPLVPMWPQELTARDGL
KLISYLTLPAEADANHDGKADKLVLFVHGGPWARDSYGYGPYEQWLANRG
YAVLAVNFRGSTGFGKAFTNAGNGEWAGKMHDDLLDAVQWAVKQGVTKPD
EVAIMGGSYGGYATLVGMTFTPDAFKCGVDIVGPANLNTLLGTVPPYWAS
FYKQLTRRMGDPATEAGKQWLTDRSPLTRVDKISKPLLIGQGANDPRVKQ
AESDQIVNAMKAKNIPVTYVLFPDEGHGFRRPENSKAFNAVTESFLSQCL
GGRLQPIGADLEGSSITVPEGADKINGLGEALKTHTQAIRK
agrtu-ATU0841: Agrobacterium tumefaciens (strain C58 / ATCC 33970) hypothetical protein atu0841, 2 reference(s)Agrobacterium tumefaciens Show
MPDKRFLSSAFGQEESGTSIPSLTRRSLLAGAMGLSAAAFLPPRAKAGIV
APEVLPLERQDYAEARKRFHTHLLRKMAAPEKSSVLGTPPGAERVTYPGG
PDGSIELVAWLSHYQPSKTLKPAVLFLHGGNATGDGHWALMKPYWEAGYV
VLLPSFRGENGQSGHYSGFYNETADALAAATYLENLPGIDRNRFFIAGHS
NGGTLTLLAAMSRKFRAAAPISAGVNSWRYFNRYSDEICFDETDEREFIM
RSSVCFGPSLKCPALLLRGTEERPFDADHQLFVDRALTSGFKIDKKLLPG
THNGVVPHAVEESIRLFNAFV
agrtu-ATU5193: Agrobacterium tumefaciens (strain C58 / ATCC 33970) peptidase, 2 reference(s)Agrobacterium tumefaciens Show
MCRYCLIVAARVGAVDDARFDMTAPDLIPIETLFGMPEFSRAQISPDGRL
VAYLAPWRGRLNIWVRPVGQGTARRLTGDDTRNIDGFSWTRDTRYLLFIQ
DTQGDENWHLHRVEVDGAEAVGGKARTVDLTPYSGVRVMGLELSAAFPSK
AFVQMNLRTPDLIDLYEVDIESAETRVAALNPGRFVRWIVTPNGPMHAFI
INDVGDHELARYENGVFTTLAKLSGRDQPIGPMPLMVAADGESVLVGCNA
GSDHTYLAAIDLATGKCRVIDSQPDCSLDTPRPEADPRFPSSLITNPVTG
ELLAVRYLGKRQQIRPLNLRFAAVLNSLQRLSDGEIGYISCDAGGRQWVA
EFWDDRHPGTTWFYEHESGEAHVLGERFSALSAERLVSVRPIDVISRDGL
TLPCHVTLPVGFDAKDEPRALPTVLLVHGGPWYRDACVYDPEVQFLANRG
YAVLQVNFRGSTGYGKAFMQAAIGEFSGRMHDDLIDGLDWLIGQGIADPA
RVAIYGCSYGGYAALVGASFTPERFTATISYSGISDLRMLVNGVVPFVQP
TLINTYLSYMGDPDIETQNRDMLARSPVSRLDCISKPLLVVHGANDVRVA
KAQADMVVERVRANGVEVDYLLNEREGHWFINEDSNIELYRKIERFLARH
LRGE
bacfr-q64t24: Bacteroides fragilis, Bacteroides sp., putative peptidase, 2 reference(s)Bacteroides fragilis Show
MRQVNLFIMSAAMMLASCGGTKDAGKTDQALIGKSDIKIEGKRMTPEALW
AMGRIGGLAVSPDGKQIAYTVAYYSVPENKSNREVFVMNADGTDNRQITH
TPYQENEVTWAADGSKLLFLSNDNGSSQLYEMNPDGSGRKQISKYDGDIE
GYSISPDGKKILFIAQVKTVKSTADKYPDLDKATGIIITDLMYKHWDEWV
TTAPHPFIADFDGKSISNIIDVLEGEPYESPMKPWGGIEQLAWNTTSDKV
AYTCRKKTGLAYAISTNSDIYVYDLNTKKTVNITEGMMGYDTNPQYSPDG
KSIAWQSMERDGYEADQNRLFVMNLETGEKRFVSKAFDSNVDAFIWSRDA
KTIYFTGVWHGETQIYSLDLANDSVRPVTSGMYDYEGVALFGDKLIAKRH
SMSMGDEIYAIALDGQTTQLTQENKQIYDQIEMGKVEGRWMKTTDSKEML
TWVIYPPQFDPNKKYPTLLFCEGGPQSPVSQFWSYRWNMQIMAANGYIVV
APNRRGLPGFGLEWNEAISGDYGGQCMKDYFTAIDEMAKEPFVDSDRLGC
VGASFGGFSVYWLAGHHDKRFKAFIAHDGIFNMEMQYLETEEKWFANWDM
GGAYWEKQNPTAQRTFANSPHLFVEKWDTPILCIHGEKDYRILANQAMAA
FDAAVMRGVPAELLIYPDENHWVLKPQNGVLWQRTFFEWLDQWLKPNETA
QK
bacld-q65m29: Bacillus licheniformis (strain DSM 13 / ATCC 14580) Bacillus sp. BT1B_CT2 hypothetical protein (putative amine dehydrogenase), 2 reference(s)Bacillus licheniformis Show
MEKADSILHALRIKDFAVHPDETQLIFDTNLNGTSNLWAMDLPDTYPYQL
SFLNQDSKGIAYNPDGSILYAGFDNDGNEQSGLYKLSLKNGTFQSLNGNQ
TDRHFAPIPVQNAVYYSSTKDNPTFLNTYRYDCLTEKEELIFEGKDGTSM
LSDVSPGEKAVSIHVYYVNSHSVCMVHTAEGVTTGIFPDETLPHMVYSSH
FASDDRLFVTTNYEAEFSYLALYTVSSGIFTPVLSIDKTDLTSIHADPNG
TFLYLIGKKGVKEVMYEYNTATGQSRQIDCPCTSISKIHCAYSGTLYILG
STPTRPTNLYVLTKGQSKWRQLTKHSVPGFSEQELSYPEVVTYPSFDGLP
IEGLLFKPSPVEANGWTIIWPHGGPQDAETFMFYDLFQLAAKMGYQLFAP
NFRGSANYGYSFFKMVEQDWGDGPRLDMTAGIDWLIDQKLADREKLFLMG
GSYGGYMSLLLHGRHPEYFRAVVDICGVSNLFSFVKTVPDFWQPMMEKWV
GNPERDYEKMKADSPVTYLENMTQPMLIIQGANDPRVVKEESDQVVDQLR
NMERNIEYLVLENEGHGFSKKENKMKVYRAIFEFFEKHRLYHAAKVEE
caeel-f44b9.1: Caenorhabditis elegans cosmid F44B9, 2 reference(s)Caenorhabditis elegans Show
MIVYIKGQKRVNRPLLPSKLQMLFLPILILNLLIITHAIDIIPREVLFQD
PKYSSVSLSPDAKQVGYVAPDENGIRNVFTRCSSCSYSRQVTFETEHPIL
NYVWTAIPDVILFTQDNHGDENTRIYKKNISATAIAADKTQRVVISEKPM
VKAMILSNNLISETVLIGMNDENPALHNIYAFNCQTDELKLVLQNRRFSI
FFFDNDLNVRLASEEGPDGEMIYYRPRSNEGARTTEQNTWVEYLRIQHDD
KAITMPITFDKSNNFMYWIMGDGSDLGNLVVFPFEDPQQKEILYTAQRAQ
IGNVLIHPTDKTLLAVTEVYHKPELFVANETFMEDLQYLVNMKPSGSMNI
VSMSIDMSTWLVTYSSSDEPYDIYLYRRWNKKAELFMSTRPELKKYTLNK
QIGFDFRARDEMTIQAYLSLPPQAPLLKSSQVPDGDRPYANLGMIPAVPQ
KMIVLVHGGPKARDHYGFSPMNAWLTNRGYSVLQVNFRGSTGFGKRLTNA
GNGEWGRKMHFDILDAVEFAVSKGIANRSEVAVMGGSYGGYETLVALTFT
PQTFACGVDIVGPSNLISLVQAIPPYWLGFRKDLIKMVGADISDEEGRQS
LQSRSPLFFADRVTKPIMIIQGANDPRVKQAESDQFVAALEKKHIPVTYL
LYPDEGHGVRKPQNSMEQHGHIETFLQQCLGGETQPFQPGQYNSSAIIKK
IGIEGAAIARQNLQIAQNQFAQQLPRGPVAPSIFYRPPVRAQRVMLAPNQ
NVMNRIFPVQG
caucr-CC1986: Caulobacter crescentus, prolyl oligopeptidase family protein, 2 reference(s)Caulobacter crescentus Show
MAGVAAAQAPTKAPTKADVFTAKDMASLDRLSDPRVSPDGRHVLYSVRTM
DYPANKASMSLWVADLKTKMAPRRLKVSDGGAASGRWSADGKTIYFTSSR
AGGTEQVFKTDVTGETATQVTATPFDVQAYKVAADGKTIVVAMAVFPDCP
DLACTEARLAAKGATKATGVVFDRLFVRHWDTWSDGTRNHLFAYGLDASG
VVQGHPVALMKGFDGDSPTKPFGGDEDFTITPDNKVAFSAKVAGKDEAWT
TNFDIWSRPLDGSDKLQNLTAANTAWDTAPVFSPDGKWAAYRAMKRPGFE
ADRFGIMLREVATGQERELAPSWDRSADAIAWSRDGKSIYATALDVGQGK
LFAIDVKTGKVSALTGEGHVTAFDVGPSGIVFASDSLKSPSELFLLPAKG
PAVKVASVSSEALKDVAWGEPEQFSFKGWNDETVHGFLVKPANFDPAKKY
PVAFLIHGGPQGSFSNAWSYRWNPQVYANAGYAVVMIDFHGSTGYGQAFT
DSISRHWGDRPLEDLQKGWSFVLSKYGFLDGDRACALGASYGGYMVNWIA
GNWNEPWKCLVNHDGVFDTRAMGYSTEELWFTEWENGGTPWQAGTTYETF
NPALHVDKWVKPQLVVQGQLDYRIPVEQGLATFTALQRRGVPSKLLYFPN
ENHWVLKAQNSVQWHKEVLDWLDQWTGNTRPGK
caucr-CC3723: Caulobacter crescentus prolyl oligopeptidase family protein, 2 reference(s)Caulobacter crescentus Show
MLSRRAIVASGVFAPALASFSIARAQASPHTIEELSAPPVDRDAALSPNG
KFIALASTRRIDENKDDSSITIIPADNPEKTLTVLPLGDRDIANVTWASD
RRLLITLVIPLRRGGPSIGTRLASTSDPDERPKARRVLAIDMDGKNSVML
FGNDQMLREVPDLGDIVDLLPDDPDHILVKAANFSAGIYCLYKVNILTGE
PELFERGTLKTRRWLTQAGVPVVRYDYNDRGTVQTIYVRAPGEAAWRFFR
KLRGDQQSKAEFEFIGAAPQPGVILALAPQGDDGALALREFDLRTLALGK
TLASKPNRDAEWVLRSRKGELMGVAFIEDRLTYQFTDPRMESVYRGLNRY
LGDVCNIRIFDISDDGMRFLARVTGPREPGTLYFYDRVTKRFDGIGQAYP
TLTPERLAPMETLSVRTRDGATITAYLTIPLAPGPRPLVVFPHGGPELRD
HYDYQTFVQVLAAQGWLVLQPNFRGSGGYGKAFADAGRKRWGDRMQEDLE
DAVAHVLASGRADPKRVAIAGASYGGYAALQGAVRNPDLYKAVVSIAGDC
DLVESIAFSRMQDGPDSPSYLYWLETIGDPAKDRDMLRAASPALHAEKVR
APVLLIHGLEDVIVAPKQSRIMQSALKSAGKSVELIELKDVGHRDLREEH
WNLVYSRTVQHIAKALA
giaic-a8bfp3: Giardia intestinalis (Giardia lamblia), Alanyl dipeptidyl peptidase, 2 reference(s)Giardia lamblia ATCC 50803 Show
MLTVHHFHPLAKNIFQGMAFAWLFLGWALSVTFDVHENIKLRRLGTFALN
PKAEAILFTQSEYVQGTDSSHSTLYYISGPGKEPIQVCPLNVHASNVLYS
SANNLYYFTDISSALDSAVNALYSFDPDTQLCTLLSNLPVDIDAIKVSPD
GSLLAFSADVYIYNHTNRPLTNAKLEQERLAALLYKAKVFTEGYMRHWDE
EAWPGLYRHLFVAPLPMTGLVTEDTVVDIMPGFDGDAPLKPFGGTESFAF
SHDGSRLAFTTQIGGHKQWMTNDSIYYVDIIRHASAAHRPVRISSTAPTC
LTCTNDGRDANPVFSSTDPDLLYYLSMNEPTSESDMLRLRRVSVSSQEIS
DLSPSFDGSFDAFTLARDEDVVFVLAHIKARAVILQCRISLGITMDTCTT
VFTGGEVSQYEFTAGENRIYMSLNSFQFPADIFSLPLSFVDRSTLTISEA
ERVTAINADIMEHWDKLYRPEEFYLKSEIDGALVHSFFFRPHNNFDTSRD
KCPLILYVHGGPESPWDDSWSYRWNPQILVEQGYCVLATNFHGSGSFGEE
FQKSIRQHWFDIPVDDTMSAWKYVHETYSYVDKEKTCAMGASYGGTHVNW
LMGHTDNITCFIVHDGIFDLTSFGLDTDELFFVIREMGGPVWEQFEMYER
WNPARSAKNFSKPALVIHGGKDFRIHEYHGIALFQSLQLRGVPSRFIYFP
TQSHWVWQPQESVVWHTEVVAWLDKYLKE
ralso-RSC0268: Ralstonia solanacearum (Pseudomonas solanacearum) Acylamino-acid-releasing enzyme rsc0268, 2 reference(s)Ralstonia solanacearum Show
MESDVNHAHRPGWRRAWAVLGCALLLATAARADDPPPAGMTEQVVEVPKP
AGIFTIRLETTIFKPAGDGPFPLIVLNHGKAHGKPAFQDRARYLAQAAAL
VARGYVVALPMRQGFARSGGAYIGGGCNVESNGIVQAEDVVAALDYLTQQ
PYVDRSRIVVMGQSHGGLTTMAFGTLAYPGVRGLVNFAGGLRNDTCVAWE
DNLVHAFGNYGKQSRYPSLWFYGDNDSYWPRPLPEKLFAAYTGAGGKARL
VDFGTFQGDSHGMFGSRAGLPIWLPEVDAFLRELGLPSGPVPASTPASAS
ADANQDTQ
strav-SAV4564: Streptomyces avermitilis putative peptidase, 2 reference(s)Streptomyces avermitilis Show
MTESTGSTSQEQQVRGETMPDWEKRFRAPRVSLPDWAEDAPHRALFVSNA
TGTYELYAWDRTTGEQRQVTDRPNGTTDGVLSPDGEWIWWFDDTDGDEFG
IWRRQRFTGGGTADGPDEPAADGLEPSYPAGLAIGRDGGTAVVGRSTDED
GSTVHVVRAGQEPVEIYRHRESAGVGDLSHDGSLIAVEHTEHGDAMHSAL
RVLRLDGSTVAELDDTKGGSVELGLEVLGFAPVDGDTRLLIGHQRRGRWE
PLVWDVASGEETDLALELPGDVGAEWYPDGSALLVAHSFEARSELFRYDL
ASRELVRVPTPAGTVSGATARPDGSVEYLWSSAAEPSVVRSTSGGIVLDP
PGMKSPGSVPVEDVWVEGPGGRVHALVQRPAGASGPLPTVFDIHGGPTWH
DSDSFAAGPAAWLDHGYAVVRVNYRGSTGYGREWTDALKHRVGLIELEDI
AAVREWAVSSGLADPDRLILTGGSWGGYLTLLGLGTQPDAWTIGIAAVPV
ADYVTAYHDEMEALKAMDRTLLGGTPEEVPERFEASSPLTYVDAVKAPVY
ISAGVNDPRCPIRQVENYVERLTARDAVHEVYRYDAGHGSLVVDERIKQV
RLELEFAERHLGR
xanax-XAC1200: Xanthomonas axonopodis (pv. citri) and Xanthomonas campestris pv. vesicatoria (strain 85-10) prolyl oligopeptidase family protein, 2 reference(s)Xanthomonas axonopodis Show
MRKWIIPAALVLLMAAGTATAQVDVGAYIKKDKFADIKLSPSGAYLAATV
PMEDKTALAIMRRSDNSIGATFVLEKNTYVSDFAWVSDTRVLISIAQKYG
LLDKPLPTGELYAINADGTGAELLVGYRARGTGLGTNIKVKKTEAVAAFL
TDPLPDDDRSVIVAIWPMSGQDPYTRAEKLDVTTGRRLPLARAPIQRASF
TTDHHGQVRFAQGAGSDNVSKLYYRKGTGDEWALINDEQVSGHVETPLGF
SQDERIAYLRVQSADGPDAIVGWDIQANRREQVLRDAVADPLEIIYRNGT
TIPVGAIFMADRPRTRFFDEHGGEARMYHSLEAAFAGNAVRVTSSTKDGR
YVMLEAYSGSNPGDFYVFDTQQNKAQHVISRRDWFDPERTATVQPIALQA
RDGMPLHGYLTLPRSAGDKHLPMVVMPHGGPFEIFDSWQFDDDAQLLAQA
GYAVLQINFRGSGNYGRHFQHAGARQWGGTMQDDVTDATRWAIAQGYADA
RKICIVGASYGAYAALMGAAKESGLYACAAGYVGVYDLPMMFTSGDIQKR
GSGENYLKQWLGDPATLAARSPVNLARQIKVPVFLAAGGEDERAPIQHSK
RMEAALRQAGTPVETLYFDTEGHGFYTEPHRRAFYAQLLAFLSKSLGGAK
AD
xanca-XCC0243: Xanthomonas campestris (pv. campestris) ( and strain 8004) dipeptidyl aminopeptidase, 2 reference(s)Xanthomonas campestris Show
MQRLLLASSLLLALSACSDKSAPANTADAAAPAAAPAATAPATAPELIPR
DALFGNPERASVRISPDGKYLSWVAPLDGVLNVWVAPVDAPDKARAITKD
TARGIRSYYWTYHSDTLLYLRDTGGDEDFHLYAVNLSDGSSKDLTPFKKT
NAEVYGISDQHPDAIMVGMNDRDAKWHDLYKVELASGTRTLVQKNTDSLD
SYLLDGNYQLRYATRATDDAGRELLVPEGKGWKSVDRIPFEDVTNTAPAG
LTDDGKTLYMLDSRNRDTAALYAIDTASNARTLLFEDARADAGSTLNDPK
TGVVQAVSTDYLREEWKTLDTSIAADLQKLKSLGPGDAGIAARTLDDRTW
IVAYSAAETPLTYYRYDRADGGKLTKLFSARPALEGKPLVPMWPQEIAAR
DGLKLVSYLSLPAEADSNHDGKADKAVPLVLFVHGGPWARDSYGYGAYEQ
WLANRGYAVLSVNFRGSTGFGKAFTNAGNGEWAGKMHYDLLDAVQWAVKQ
GVTTPQDVAIMGGSYGGYATLVGMTFTPDAFKCGVDIVGPANLNTLLGTV
PPYWASFYKQLTKRMGDPATAAGKQWLTERSPLSHVDKISKPLLIGQGAN
DPRVKQAESDQIVNAMKAKNIPVTYVLFPDEGHGFQRPENSKAFNAVTEG
FLSQCLGGRAQPIGADFEGSSITVPEGADRITGLADALKTHTQAIRK
xanca-XCC3320: Xanthomonas campestris (pv. campestris) ( and strain 8004) prolyl oligopeptidase family protein, 2 reference(s)Xanthomonas campestris Show
MQGTQRCAWAAAMLLMWMGGQAWAEPVPPAEAFVESGPISSPSMSPDGKH
LAVSADLGEGSYALVVYRIADMQSTTMLRLPRYELPVRIAWVSDRRLVIG
KGRKLGSLEEPLPMGEIIATDLDGSNQRYVYGYLQSTRNAGLERGFGYIE
GLPAHPNGHFYMRRLSLDSRHSMLYDVDTTTTTHRLMADIDVPGLRFVLD
NAGVAQYAYGTDDNDNSLLYRRNGNGWAALQQVQASWRPFAFASQPGRVY
GWYNDAGGPAALVSSTLDGQQRSVLAADPFYTVDDLQWGPMPQPPFAARL
GPGKPKLQYLDDSAEARLHRSLSETLAGQYVDFINFTEDGNGLLLHAYSD
RNAGDWYIFNRTSNTLKLVVKARNALQPAQMSERRMVTFQARDGLTLDGV
LTVPNTAAKGTRLPMILLPHGGPHADGDGWAFDTDAQFLASRGYLVLQVN
YRGGHGRGHNFERAGYRQWGERIQDDLVDGVRWAVAQGLADQSRICSYGA
SFGAYAAMMVQVKAPELFRCAVGLAGIYDLQMMYSKGDINRSDYGINYLE
RAIGRDAADLAAHSPVSLADRIKVPVLLVHGEEDERAPFAQAKSLRAALT
RSGNAPQWMAVPKEGHGFYKDANQIAFYRTLERFLAEQLGNAVPASPAST
ASSAPQ
xanor-q5guj3: Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) dipeptidyl anminopeptidase, 2 reference(s)Xanthomonas oryzae pv. oryzae Show
MQRLLLVSSMLLALSACSDKTAPASKNAATPTPATAAPAAPPELITRDAL
FGNPERANVSISPDGKYLSWVAPLEGVLNVWVAPVDAPDQARAITKDTAR
GIRNYFWTYQPNTLLYLRDNGGDEDFHLFSVNLTDGSSKDLTPFNKTNAE
VYRVSAQHPESIMVGMNDRDAKWHDLYRVDLASGTRTLVQKNTERLDAYL
LDGDYQLRYATRATDDAGRELLVPDGKRWKSVDRIPFEDVTNTAPDGLTE
DGKTLYMQDSRNRDTAALYAIDTDSNARTLLFESPRADVGNTLNDPKTGV
VQAVSTDYLREEWKPLDNGIAADLQKLKSLGSGDANVAARTLDDRIWIVG
YSAAETPLTYYRYDRANGGKLTKLFSARPALDGKPLVPMWPQELTARDGL
KLVSYLTLPAEADANHDGKADKPVPLVLFVHGGPWARDSYGYGPYEQWLA
NRGYAVLSVNFRGSTGFGKAFTNAGNGEWAGKMHDDLLDAVQWAVKQGVT
QPDDVAIMGGSYGGYATLVGMTFTPDAFKCGVDIVGPANLNTLLGTVPPY
WASFYKQLTRRMGDPATEAGRQWLTERSPLSHVDKISKPLLIGQGANDPR
VKQAESDQIVNAMKAKNIPVTYVLFPDEGHGFRRPENSKAFNAVTESFLS
QCLGGRVQPIGADLEGSSITAPEGADKINGLPDALKTHTQAIRK
xanor-q5gvh5: Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) prolyl oligopeptidase family protein, 2 reference(s)Xanthomonas oryzae pv. oryzae Show
MAVGCVCALLAAMPGQAQEALDLTPYLKRDQIERIKISPDGDYFALTMPM
EDRTVLGIVRRKDKAATARVTSGVNSVVDDFWRAGNERVVISMAQRFGSR
DETAAIGELHAIDADGKNGRLLASPYGTNPDINGAQLKMDLDPATYMLET
LPDDQRNILVATIRFGGDPNVRVDKLDIQTGRRRTVATAPVRRADFVTDR
QGRIRFASGADVTNASKLSYRDNDDAPWRLINDAASSKHREFPLGFSADG
SLAYMRVEQDTGTDVLAAWDPITGKSTPLLHDDTVDPYRILRDLDGITPI
GASYMSDRVRNRFFDEKAPTAKLYRSLEKAFDGNAVYITSATRDRRLVLV
YVWSDRNNGDYYLFDTVNTHADRVFSRREWFPPDAVPASTQVSFTARDGL
ELHGYLTRPLHAEAGTPLPLIVMPYGGPFGIFDKWEFDDDTQLQAVAGYA
VLRVNYRGSANYWRSFTVAGAKEWGGCMQDDLTDATRWAIAQGMADASRV
CLYGASDGGYAALMGVAKEPGLYRCAAGYVGVYDLDMMARDTARYARWAK
NWTGDWLGARDTLAARSPVNLASQIKVPVFLAAGGKDERAPIEHTKRMER
ALNAAGVPVESLYFPNEGHGFCAEPHRRAYYTRLLAFLSKQLGGSTAK
9bact-KY203037: uncultured bacterium EH120 clone 00152_2_12ROV11 esterase/lipase, 1 reference(s)uncultured bacterium Show
MAKRENRKGLRHFPISVSGILVFLLMAVSGFGQGPLCIPVEYQTSPFFVH
FRGAGNPTLVVIHGGFSSTLQADLFCCEFARILGQRYNIISVDYRFSSLG
GGELVDVLRGINLAENRWRTPKSQIHLIGASHGGFLALMAASQEEVGSVI
DAYGPTNWLIQWRYVREHRPDILKRWRIYLAISRSACRDMNLEFNQCLVQ
RSVVNPRHLQGLQEPILILHGAKDRLVPVKESKLLARELKKRGRKVTLVI
LPQRGHAFPLWKGKPLGLVERLLKEEEGR
9bact-q6wlc7: uncultured bacterium csw020, 1 reference(s)uncultured bacterium Show
MRADSKGDEMRISARWSMVCHALLLASSLCLMATQARAQAAPEPLKPPST
QDFSQLPMVMDLSLSPDGQHVAGLLNIDDKTLLFTRGVHDQKLVYLSSTD
NKAFKIAWLQWASNDRLVFGLRFAASRDFIGTVETRLMSVKRDGTELINL
VSTSPFSSNRFQSQFQDRVIDWLPGDGHHILMELNEGYSYSPAVFKVNLD
TGMRQMVHTPKRHVRNWVTDQTHRVRLGVLHDEAKREVQVCDPDGKNWRT
LWRYEVFSKDAIYPLGFGLNPQELYISANHEGRLAVFKVNLASPDLQHEL
VLSHAELDVSGQLIRSQATGQIIGIHTGIQDEQRPDFWDPSLRLLARAID
KALPERFNSLIELSRDEQHYLIYSVGNGKPGEYYLGNRKTGDLALVAETH
PELPQASLVGKQPVQIKARDGLVLTAYLTRPAKSPGALPLVLLPHGGPDS
RDNSRFDVWTEFLASRGYAVLQVNFRGSAGYGHDMMVAGLQRWGLEMQDD
LSDAVQWAIAQGVADPKRVGIVGFSYGGYAALMGSVKTPDLFRCAVSVAG
VTDLIDLWYHQNQYIGGAAIADKQIGNAWNDRKRLTETSPALQAERIKVP
VLLIHGTDDRTVPFEQGEAMDKALRRAKVPHRFVELEGGDHQLSRNSHRL
MVFKELEDFLAQNMGAPKVLAQQQQP
9flao-q5vk61: Flavobacterium columnare prolyl oligopeptidase, 1 reference(s)Flavobacterium columnare Show
MDLRDNGGGSKMKKLALLSVTLMSINSGIAQNTMTPDLLWKLGRVTPLGV
SKDGKNIIYKVATPSIEENKSISKFYTIPITGGNANEIKEYTELIKNKNI
SPDGMYLLSDKEVKITPVLGKDFYPELSLSEAQVYDGLDYRHWDTWRDGT
YNHVFFGGVPAPNVRLAPPIDIMEGEPYDAP