Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Prolyl_oligopeptidase_S9

Prolyl_oligopeptidase_S9


Genes:Proteins in Prolyl_oligopeptidase_S9 (189)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
acicj-a5fwk4: Acidiphilium cryptum, Acidiphilium multivorum, dipeptidyl anminopeptidaseAcidiphilium cryptum JF-5 Show
MDRTTDTTALPLIPRAALFGNPRRAGAQISPDGGTIAFLAPRNGVMNLFV
APRGRIDAARPLTDERRRGIPGYAWAHDGRHLLVVKDNDGDENFHLHAVD
RETGAMRDLTPHGPIQASIVKLSPRHPGEAVVSHNARDPQWPDLYRIEIA
TGRSTMIAENPGLAGFDVDEDFALRLAARLEGDGSQTVLRPDGAGGWAPF
MRFAPEDAMTSGVLGLFTADGRATLMLSSAGRDTAALFRLDLETGEATML
AEDARADIGEIIVRLHENTPLAYGVNYERNRYVALDPAIQPDLDALDAAG
IGDWGIQSRSEDDRFWIVGAASDTAPGVAWLYDRKTRALEKLYDTRPDLA
DAPLAPMRPVVIAARDGLSLVSYLTLPADGGSAPRPLVLLVHGGPWARDS
FGFNPYHQWLANRGYAVLSVNFRASTGFGKAFLNAGDREWGRAMDDDLLD
AVDWAIGQGIADPSRIAIMGGSYGGYATLAAMTRNPERYACGVDIVGPSN
LETLLATIPPYWEAGRSIFTRALGDPATPEGAALLRERSPVHQAARLARP
LLISQGANDPRVKQAESDQMVAALKAKGIAVTYVLFPDEGHGFARPENSI
AFNAITEHFLAAHLGGRAEALAAEEIGRSTAQLLEGAEILP
acice-q2dzr5: Acidothermus cellulolyticus 11B alanyl dipeptidyl peptidaseAcidothermus cellulolyticus 11B Show
MPAQLPPDGEVRAKPTDSDAAHPFADLDRYVAIPRVAGLILAPDGRRLVC
VVQTPAADNSAYVSALWEVDPAGEAPPRRLTFSAEGETQPAFTADGDLLF
VSKRSSPSPSPGSAETETTAGLWRLPASGGEAYQVAAPSAGITKVLAARA
AGVVLVVAPALPGPYEEDAARRKARREAGVSAVLHESAPVRHWDRDIGPD
FPRLLRVDLDGTAVSSAQPVSGRLHDLTPDPGRALDEVGLAVSDDGRIAV
CGWRTPLGRGVEGVSLVAIDTTSGERRVLLAATAEPVKQNFDQPAISPDG
RYVVCVCEEEGDRDHPPRCSLRLVDLHSGAVTPLAPEFPYWPANPRFSAD
GSAVFFVADEQGRCPVFRVDIATGQVRRLASDGAYSEVNVSPDGKYLYAL
RSRIDEPPRPVRLEVDAVDQKPMEIPAPGEILSYPGRVTEITATAVDGVP
LRAWLVLPDGATAEHPAPLALWIHGGPLMSWNSWSWRWNPWLLAARGYAV
LLPDPGLSQGYGQEFITRAWRDWGPVPFADLMTITDAAAARADIDETRIA
AMGGSYGGFMANWIAGHTDRFKAIVSHASLWALDYFTGVTDHAGEWLREW
GHPVHEPERYERNSPHRHIAAIRTPMLVIHGDKDYRVPIAEGLKLWADLV
WHGCDAKFLYFPDENHWILKPGNVKAWYATVLAFLDHYVRGLPWRRPELV
acice-q2e0x1: Acidothermus cellulolyticus 11B acylaminoacyl-peptidase (EC 3.4.19.1)Acidothermus cellulolyticus 11B Show
MTESTPTTPPNEPAWQLRFRAARMTLPRWARLRPERSIFTSNASGTVEIY
AWDRSRGTIHQLTKRPAGTYLAAIDPAGEQVWWFDDDGGNEFGVWRRQPF
PADVPDDARRSALPASSDLPPSYPAGLALGRSGTAVLGRCTDAATSVHLV
RPDGSAHQLIPDLADGEVGALSADGRLLALAHAEHGDARHKALRVVALDD
SGTRTVADLWDGPGLGLTVVDFAPRDGDPRLLVLHERRGRVQPLVWNPLT
GEQFDPDIDLPGDMYAEWYPDGAALLVGHDVHARTELYRFDLASGAWTRI
PTRAGTISGATVRPDGVVEFLWSSSAEPPAVVDDTGRVVIQPPGPAAPAS
VPATDAWVDGPGGRIHALISRPPGKPPYPTVFLVHGGPASHDTDSFTPAV
AAWVDAGFAVVRVNYRGSTGYGKAWRDAIEGRPGLTELADLRAVRDWAVT
TGLSDPRRLVLAGGSWGGYLTLLGIGVMPDAWSVGIASVPVADYVTAYYE
EMEPLKAFDRALFGGTPEEVPERYREASPITYIDQVRAPVFILAGENDPR
CPIRQVENYVDALARRGITHEVYRFDAGHGSLVTEERIRQVGKEIAFALR
HLGMHRDAFAEFATLAAP
aerpe-APE2441: Aeropyrum pernix 591aa long hypothetical acylamino-acid-releasing enzyme, 1 reference(s)Aeropyrum pernix Show
MLVRRFLAVKSSHTPRIDPSTGCIYYLSDSASSQPVIWKSCESRNDVWLP
WERRVGSLEIAPDGLVAFSTDKDGDERWSIYIAGEDLGVRLVAGEDGSIN
MIGPWSPDGRLLAFTSNKRNGVDFDLYVFDREKGSVSIVVEGEGIIAASS
WIDGSRLLAVKRNSNLDSDILAVNVYKGEAKVLTRHRGEELNTSPRPIGG
GKALFISNMDSEFTGIALIDLQTGDRRLVFREQWDVEALEVSGKTVVYSL
NVDGESRVYTTKIDERGSLLQPRPIEGLPRGSLLSLDLNEKLGLAVFSLS
TPKHGIEIYIAGLGRSASRLTVSPKAWLREDEFVEPEHFSYESFDGIKVR
ALLYKPDKPLYTPPPAVVYLHGGPESQERVRFNVFPQALAAIGIATIAPN
YRGSTGYGRRFVHLDDVEKRMDAVRDVYYAVKAAVEAGLVDGSRLCVMGG
SYGGYLTLMSLAIYPDLWKCGVEIVGIVNLVTFIRNTSPYRRRYRIAEYG
DPDVHGEIMLKLSPITYVENMKAPLMVIHGAKDPRVPVSEAEQLVEALSS
RGVRVRYVRLEDEGHGIVKLENKLRVYREALEFIYENLASR
agrt5-q7d3t6: Agrobacterium tumefaciens (strain C58 / ATCC 33970) agr_pat_205p, 1 reference(s)Agrobacterium tumefaciens Show
MTAMAEVTEHTIDRGDGARVQLFQARASDRRNGAILFVHGNQGGLLLGGQ
EAVEDGSLVRFSSRLGITAAAVSQPGFGTSDGPADFCGPSTQKAIVAALD
FLKRQPSVDPERIVLYGNSRGAVASAMVATKVADLKAIILTGGVYDLRDA
YKTSARGLQEAIRNEAGISDEAFLDRSALYHAHSIRSETLLLHGKYDDRA
SVDQAERFSEALARSGVPVRFHALDGGHRLPRDQVTPILRDFLTRVFAPM
ATIH
agrtu-ATTS: Agrobacterium tumefaciens (strain C58 / ATCC 33970) dipeptidyl peptidase IV, 3 reference(s)Agrobacterium tumefaciens Show
MSAISRHIIDRGDGAAVELFQAQTAFPPKGAILFVHGNQGGLLLGAKEAV
DNGMLLRFSSRLNVTAAAVSQPGFGASEGPTDFCGPTTQQAIIAALGFLQ
KQSLIDPERIILYGNSRGAVASAMVATQMPDLRAVILSSGVYDLKRAYQS
SPRGLQLAIEKEAGLTNTAFLDRSALFHSHKIRAETLLLHGKHDDRAPVD
QAERFANAISEAGLSVDLQTFECGHRIAGELTAPVLRNFLTRILAPAATF
H
agrtu-ATU0841: Agrobacterium tumefaciens (strain C58 / ATCC 33970) hypothetical protein atu0841, 2 reference(s)Agrobacterium tumefaciens Show
MPDKRFLSSAFGQEESGTSIPSLTRRSLLAGAMGLSAAAFLPPRAKAGIV
APEVLPLERQDYAEARKRFHTHLLRKMAAPEKSSVLGTPPGAERVTYPGG
PDGSIELVAWLSHYQPSKTLKPAVLFLHGGNATGDGHWALMKPYWEAGYV
VLLPSFRGENGQSGHYSGFYNETADALAAATYLENLPGIDRNRFFIAGHS
NGGTLTLLAAMSRKFRAAAPISAGVNSWRYFNRYSDEICFDETDEREFIM
RSSVCFGPSLKCPALLLRGTEERPFDADHQLFVDRALTSGFKIDKKLLPG
THNGVVPHAVEESIRLFNAFV
agrtu-ATU5193: Agrobacterium tumefaciens (strain C58 / ATCC 33970) peptidase, 2 reference(s)Agrobacterium tumefaciens Show
MCRYCLIVAARVGAVDDARFDMTAPDLIPIETLFGMPEFSRAQISPDGRL
VAYLAPWRGRLNIWVRPVGQGTARRLTGDDTRNIDGFSWTRDTRYLLFIQ
DTQGDENWHLHRVEVDGAEAVGGKARTVDLTPYSGVRVMGLELSAAFPSK
AFVQMNLRTPDLIDLYEVDIESAETRVAALNPGRFVRWIVTPNGPMHAFI
INDVGDHELARYENGVFTTLAKLSGRDQPIGPMPLMVAADGESVLVGCNA
GSDHTYLAAIDLATGKCRVIDSQPDCSLDTPRPEADPRFPSSLITNPVTG
ELLAVRYLGKRQQIRPLNLRFAAVLNSLQRLSDGEIGYISCDAGGRQWVA
EFWDDRHPGTTWFYEHESGEAHVLGERFSALSAERLVSVRPIDVISRDGL
TLPCHVTLPVGFDAKDEPRALPTVLLVHGGPWYRDACVYDPEVQFLANRG
YAVLQVNFRGSTGYGKAFMQAAIGEFSGRMHDDLIDGLDWLIGQGIADPA
RVAIYGCSYGGYAALVGASFTPERFTATISYSGISDLRMLVNGVVPFVQP
TLINTYLSYMGDPDIETQNRDMLARSPVSRLDCISKPLLVVHGANDVRVA
KAQADMVVERVRANGVEVDYLLNEREGHWFINEDSNIELYRKIERFLARH
LRGE
anade-q2im58: Anaeromyxobacter dehalogenans (strain 2CP-C) peptidase s9, prolyl oligopeptidase precursorAnaeromyxobacter dehalogenans Show
MLTAALVALALASVPRPFTVDDLLALERAGDAAISPDGASVAYTVATSAP
GGEKLVSALHLVPAAGGAARRLTFGEERVSSPAFSPDGRRIAFLSNRKGG
TQAWVLDLQGGEARRVTDLPGGVSELRFTPDGAALVVASDVDPACGADAA
CNRKADAAAEVRPHLADRLLFRHWDEWRERVRTHLVRVPLDGGAAVDLTP
GDRDAPPVQRGSGDDLAFSPDGKTLYYVAVSDPVEATSTNGDVYAVPLAG
GTPRRVTIAPGWDGAPRPSPDGKRLAWLAQPRAGYEADRYHVMVAAADGS
GARDLTAGFDRSAADLVWARGGKALRFTAESEGVHALYEVDLAGKVTELY
RGRNLARVSWSRDGARLAALVDGLAAPPEVAVLEPGGRGAQPRPLTALGA
KGLAGIALGEVRPLSATGKDGQALHGWMVLPPGHRDGERHPAVVLVHGGP
QGAWNDAWSFRWNPMLYAARGWTVVLPNPRGSTGFGQGYTDAVRANWGGT
PYDDIMRLTDAAVATGAADGGRMCAAGASYGGYMVNWINGQTDRFRCLVA
HAGNFDLRMAYYDTEELWFPEWELGRPWETPEAFERWSPSAFVKQWRTPT
LISHGEKDFRVTVTQGFAAFTALQRRGIPSRLMVFPDEGHWVLKPRNAKV
FHDEVLGWIGRWLDSPAPQASAPR
anade-q2ip31: Anaeromyxobacter dehalogenans (strain 2CP-C) peptidase s9, prolyl oligopeptidase active site region precursorAnaeromyxobacter dehalogenans Show
MHALLLALVAAAGAATAPLDLAPVPGLPNLLQLGVPEVPPEVSARLEQYE
NARAAVLRDVSADGRAMLVTTRFGSTAQLHLVAAPLGTREQLTFGDEPVS
DAAFLPGRPDSLLYLQDEGGGEFFQLYRLDRRTGRSELLTDGRSRHGDLV
VSPDGRRFAYSGTGRNGKDADVYVAETDRPAAARRAVEAEGSWSPLDFSR
DGRRLLVRRYRAASDADLELVDLATGARTPLLAGKGSVGGAAFSADGRHV
YAITDRGADHAALVRVDLAHPAAPPRPVAPGVAWDVEQVVVARDGTVAFT
ANADGVSLLHAVDPRTGRLRGVPLPGRGVATLRFPPGRSDLLAVGLVSAT
SPWDAWTVELRGGKAVRWTRSEVGGLDPAGFVEPELVRYPTTGGAEVPAF
LYRPRGGGRAPVVVNWHGGPEGQHRPAFSPMVQFLVAELGVAVLQPNVRG
SAGYGKDWLALDDGVRREEALKDVPATFQFIASRPDLDAARAVVWGGSYG
GYMVLATLTLFPGLARAGVDVVGISSLPSFLESTQAYRRDLRRAEYGDER
VPEVRAVQERISPLGRAGAIRVPLLVVQGANDPRVPRSEAEQIVRAVRAN
GQEVWYVLALDEGHGFKKKENRDHADAVTVAFLQRMLAGAPPAAPPRGAA
SAR
9micc-q4nkj0: Arthrobacter sp. FB24 peptidase s9, prolyl oligopeptidase active site regionArthrobacter sp. FB24 Show
MASEDSAILSEQPATPFHDIDHYLAIPRVSGLALSPDGQRLVTTVSTLNG
KGTEYVTALWELDPAGEKHARRITRSAKGEAGAAFAATGDLYFTSARPDP
DSPDDDPVSALWQLPADGGEARVVLSRAGGISQVITAKDSGATFVTASVL
AGSADEEADEARRKSRKDNKVSAILHSGYPVRYWDADLGPDQPRVFAVEP
GEDKDPGKPATVDAAAPLKLRNLTPEAAGMLRNADSVVSPDGRTIYTSFD
KPLAKADSRSVLVAIDVATATHKILLDREGMSYFAGPVSPDSRTLVVLSE
SDTTPRQAPRVKLHLLDVSAPGEPEDNLRPLAHEWDRWAIKAAWLPDGAA
LLVTADDDGASPVFRITPAAAGAGAGEDQVTRVTLDAAAYADVVVSPDGL
SAYALRSSYEFPPEAVRIDLASGQVTRLQAPAERPRIQGSLERIEATAAD
GARIPAYLALPEGASAQNQAPLLLWIHGGPLGSWNAWTWRWNPWLLVARG
YAVLLPDPALSTGYGQSYIQRGWGEWGKAPFTDLMTITDAVVQRPDIDAS
RTAAMGGSFGGYMANWVAGQTDRFNAIVTHASLWALDQFGPTTDASQYWL
KEMTAEMALANSPHLHVEKISTPMLVIHGDKDYRVPIGEGLRLWYELLSK
SQLAADDNGRTPHRFLYYPDENHWILQPQHAKVWYGVVEHFLARNVLDQD
APLPAELGL
artbe-DPP5: Arthroderma benhamiae (Trichophyton mentagrophytes,) T. equinum (Horse ringworm fungus),T. tonsurans, T. rubrum, T. verrucosum, T. schoenleinii, T. interdigitale, Arthroderma gypseum, Dipeptidyl-peptidase 5 tri m 4 allergen (allergen tri s 4), 1 reference(s)Arthroderma benhamiae Show
MAAAKWLIASLAFASSGLAFTPEDFISAPRRGEAIPDPKGELAVFHVSKY
NFDKKDRPSGWNLLNLKNGDISVLTTDSDVSEITWLGDGTKVVYVNGTDS
VEGGVGIWISDAKNFGNAYKAGSVNGAFSGLKLAKAGDKINFVGYGQSTT
KGDLYNEAAAKEAVSSARIYDGLFVRHWDTYVGTQFNAVFSGSLTKNGDK
YSFDGKLKNLVQPVKYAESPYPPFGGSGDYDLSSDGKTVAFMSKAPELPK
ANLTTSYIFLVPHDGSRVAEPINKRNGPRTPQGIEGASSSPVFSPDGKRI
AYLQMATKNYESDRRVIHIAEVGSNKPVQRIASSWDRSPEAVKWSSDGRT
LYVTAEDHATGKLFTLPADARDNHKPSVVKHDGSVSSFYFIGSSKSVLIS
GNSLWSNALYQVATPGRPNRKLFYANEHDPELKGLGPKDIEPLWVDGART
KIHSWIVKPTGFDKNKVYPLAFLIHGGPQGSWGDSWSTRWNPRVWADQGY
VVVAPNPTGSTGFGQKLTDDITNDWGGAPYKDLVKIWEHVRDHIKYIDTD
NGIAAGASFGGFMVNWIQGQDLGRKFKALVSHDGTFVGSSKIGTDELFFI
EHDFNGTFFEARQNYDRWDCSKPELVAKWSTPQLVIHNDFDFRLSVAEGV
GLFNVLQEKGIPSRFLNFPDETHWVTKPENSLVWHQQVLGWINKWSGINK
SNPKSIKLSDCPIEVIDHEAHSYFDY
artot-dpp5: Arthroderma otae (Microsporum canis) Dipeptidyl-peptidase V, 1 reference(s)Arthroderma otae Show
MAPAKWLIASLAFASTGLAFTPEDFISAPRRGEAIPDPKGQFAVFPVSKY
NFDTKDRPSGWNLLNLKTGDISVLTTDADVSEITWLGEGTNLLYVNGTDS
VKGGVGIWISDAKNFGNAYKAGSIPGAFQGFKLAKSGDKINFVGYGQSTT
KGDLYNEAAIEKPVSSARIYDSLFVRHWDAYVGTQFNAVFSGALTKNGNK
YSFDGKLKNLVQPVKYAESPYPPFGGSGDYDLSPDGKTVAFMSKAPELPK
ANLTTSYIFTVPHDGSKVAEPINKRNGPRTPHGIEGASSSPVFSPDSKRI
AYLQMATKNYESDRRVIHIAEVGSNKPAQRIASNWDRSPESIKWSSDGRT
LYVTAEEHATGKLFTLPSDARDNHMPSAVKHDGSVSAFSFVGSSKSVLIT
GNSLWSNALYQIATPGRPNRKLFYANEHDPQLKGLGPNDIEPLWVDGART
KIHSWIVKPTGFDKNKVYPLAFLIHGGPQGSWGDNWSTRWNPRVWADQGY
VVIAPNPTGSTGFGQKLTDDITNDWGGAPYKDLFKIWEHVRDNLKYVDTD
NGIAAGASFGGFMINWIQGQELGRKFKALVSHDGTFVGSSKIGTDELFFI
EHDFNGTFFEARQNYDRWDCSKPEYVAKWSTPQLVVHSDYDFRLSVAEGV
GLFNVLQEKGVPSRLLNFPDESHCVTKPENSLVWHQQVLGWINKFSGINK
SNPKAIKLSDCKVEVIDHEAGSYFDY
aspcl-dpp5: Aspergillus clavatus Dipeptidyl-peptidase V, 1 reference(s)Aspergillus clavatus Show
MGALTWLSVVAAAASTALAMTPEKMISAPRRSEVIPNPSGEIGVFSTSQY
SFEKHKRSSWWSLLDLKTGQSKILTNDSSVSEILWLGTDDSTLLYVNGTN
ADVPGGVELWVTQVSSFTNGYKAASLPAAFSGFKTVTTKSGDIRFVAYAQ
SYANGTAYNEELVEKPLSSARIYDSIYVRHWDSYLTTTFNAVFSGTLKKG
NNKKGYTLDGAVKNLVSPVRNAESPYPPFGGASDYDLSPNGKWVAFKSKA
PELPKANFTTAYIYLVPHDGSEKAFAINGPDSPGTPKGIKGDANSPVFSP
NSEKLAYLQMKDETYEADRRVLYVYSIGSKKTIPSVAGNWDRSPDSIKWT
PDGKTLIVGSEDKGRSRLFAIPATARDDFKPKNFTDGGAVSAYYFLPDRS
LLVTGTAIWTNWNVYTASPAKGVIKTLASANEIDPELKGLGPSDVSEIYF
KGNWTDIHAWVVYPENFDKSKKYPLAFLIHGGPQGSWADSWSSRWNPKTF
ADQGYVVVAPNPTGSTGFGQKLTDEIQNNWGGAPYDDLVKCWEYVNKNLP
FVDTEHGIAAGASYGGFMVNWIQGNDLGRRFKALVSHDGTFVADAKISTD
ELWFMQREFNGTFWDARDNYRRFDPSAPEHIRQFGTPQLVIHNDKDYRLA
VAEGLSLFNVLQERGVPSRFLNFPDENHWVVNPENSLVWHQQVLGWINKY
SGIEKSNPGAVSLDDTIVPVVNYN
aspfc-dpp5: Aspergillus fumigatus (strain CEA10/CBS 144.89/FGSC A1163) (Sartorya fumigata)(and strain Af293) Dipeptidyl-peptidase V, 3 reference(s)Aspergillus fumigatus Show
MGAFRWLSIAAAASTALALTPEQLITAPRRSEAIPDPSGKVAVFSTSQYS
FETHKRTSWWSLLDLKTGQTKVLTNDSSVSEIVWLSDDSILYVNSTNADI
PGGVELWVTQASSFAKGYKAASLPASFSGLKAAKTKSGDIRFVAYGQSYP
NGTAYNEELATAPLSSARIYDSIYVRHWDYWLSTTFNAVFSGTLKKGHGK
NGYSLDGELKNLVSPVKNAESPYPPFGGASDYDLSPDGKWVAFKSKAPEL
PKANFTTSYIYLVPHDASETARPINGPDSPGTPKGIKGDSSSPVFSPNGD
KLAYFQMRDETYESDRRVLYVYSLGSKKTIPSVAGDWDRSPDSVKWTPDG
KTLIVGSEDLGRTRLFSLPANAKDDYKPKNFTDGGSVSAYYFLPDSSLLV
TGSALWTNWNVYTAKPEKGVIKKIASANEIDPELKGLGPSDISEFYFQGN
FTDIHAWVIYPENFDKSKKYPLIFFIHGGPQGNWADGWSTRWNPKAWADQ
GYVVVAPNPTGSTGFGQALTDAIQNNWGGAPYDDLVKCWEYVHENLDYVD
TDHGVAAGASYGGFMINWIQGSPLGRKFKALVSHDGTFVADAKVSTEELW
FMQREFNGTFWDARDNYRRWDPSAPERILQFATPMLVIHSDKDYRLPVAE
GLSLFNVLQERGVPSRFLNFPDENHWVVNPENSLVWHQQALGWINKYSGV
EKSNPNAVSLEDTVVPVVNYN
aspfu-q4wce3: Aspergillus fumigatus Af293 oligopeptidase family proteinAspergillus fumigatus Af293 Show
MVFSSYDMAALSTSPTSSSLPPSVSSTAPPDLTPYHPSLFGIAVCNIYVQ
YNNLLSTSYTVPSVQPNRIVYPSTLGAELIKTALITVETDMTIRSMKFTP
EVLLGAPRRSGPIPNSSGTLAVYTQTSYSFDSHSKTNEIRVLDIATGRSA
LITNDPGASSPQWLENSDQLVWLKTKANGNTSFIVGDAREVDKTYTAGTV
PGPVSDLKVTVVEPGKIGFAVVGKANPDGSLYNPHDAKKPLSSGRLYTSL
FVRHWDSWIEPQRNAIWYGLLQRAPLSPATRQAGRYSVSGLTNLISVCGL
TGVESPIPPFGGSGDFDISPSAIVFVAKDPNLNPATHTSCSCYYCPMFSW
TGVGALEAKVCTVKGLEGAMSSPVLSSDGSSIALLGMREDGYESDKNRIL
YVPNPWNGEMIEIFASADGKGQWDLSPSGLTFAKDDQSLFVQVEEQGRGV
LYQLPLDNVRHSTPDVLKKLTHSGYVTDVFPLVAKSSNLLIASNSLVDNS
LWTIIDTQDTSKVRVISSIGRGGAAFGLSPTQVDEIWFKGAEDHPVHAWV
VKPSNFQPGNKYPLAYLIHGGPQGAWNDQWSTRWNPAVFAEQGYVVITPN
PRGSTGYGQPFTDAIRGSWGGLPYIDIEKGLDYIEENLDYVDTTRAVALG
ASYGGYMMNWIQGHPLGRRFKALVTHDGVFSMTSQLASEEQYFPLHDLGG
PIWKVPENWEKWDPSRFTEHWQTPHLIIHNELDYRLTIAEGLAAFNVLQM
KGIESAFLTFPDENHWVLNPENSLVWHQTVFNWINKYVGLPPVTDEKRDA
FSSKKTPLEKRVAGLSLS
emeni-q5ba58: Aspergillus nidulans FGSC A4 hypothetical proteinAspergillus nidulans FGSC A4 Show
MGALRWLSLAAAASSALALTPEQLISAPRRSEAIPNPSGNIAVFSSSQYS
FDTHESSSAWNLLDLRSGKITPLTNDSNVSEIVWLNDSTLLYINGTNAQI
PGGSELWVSGLSNFPSGYKAASLPASFSGLKAVTTKSGDIKFVAYAQSYR
NGTAYNEELAETYLSSARIYDSIYVRHWDTYLTTTFNAVFSGTLKKTQHA
RYASAGSLKNLVAPIPNAESPYPPFGGSSDYDISADGKWVAYKSKAPDVP
QANHTTAYIYLVPHDGSETPVPINGPGSAPEGIEGDSNNPVFSPDSKSLA
YLQMKDPTYESDRRVIYIYDLASKKITPLATEWDRSPDSLKWTDKSTIVA
GSEDEGSGNLFLIPVKKATGDFIPEKLTNGKYASAFYLASGNTLVVTGST
LYSSWYVDLVSLNPKRGTIKNLVSAHEIDPELSGLGPEDISDIWFAGNWT
DIHAWVIYPEGFDKSKTYPLAFLIHGGPQGAWYNSWSSRWNPKVFADQGY
VVVAPNPTGSTGYGDELTDAIQNNWGGAPYEDLVKAWEYVRDNLDYVDTD
RGVAAGASYGGFMVNWIQGSDLGREFKALVTHDGTFVADAKISTEELWFM
EREFNGTFWDVRDNYRRFDPSAPERILRFATPHLIIHNDLDYRLPVAEGL
SLFNVLQERGVPSRFLNFPDENHWVTSPENSLVWHQQVLGWLNKYSGIAE
DNEDAVTLEDTVVPVVNINPPA
emeni-q5bda2: Aspergillus nidulans FGSC A4 hypothetical proteinAspergillus nidulans FGSC A4 Show
AVPNSTGTLAVYTQTTYSFESHSKTNEIRVLDLKTGRSALITNDPGASSP
QWIDNTDQLIWLKSKGNGNTSLIIGDARQADRTYTAGTVPGPVSDLKVTV
IESGKIGFAVAGKSNPDGTLYNPQDAKAPHSTGKLYTSLFVRHWDSYIEP
QRNAIFFGLLQRAPLSPATRQAGKYSVSGITNLIAVCGLTGVESPIPPFG
GGGDFAVSPSAIVFVARDPDVNPALHTACSCYYCPMFSWTGVSAVESRIC
RVQGLEGAMSSPVLSSDGSSIAVLAMRQDGYESDKNRILYVPNPWSGEMI
EAFASANGKGLWNLSPSGLTFSNDDNYLYIQAEEYGRGVLFRLPVANIRH
STPNMLKKITSSGYVTDVHPVTSKSSHLLISSNSLVDNSIWTVVDPANPA
DAHVISSIGHGGAAFGLSAAQVDEIWYRGAEDTPIHAWVVKPSNFRPGSK
YPLAFLVHGGPQGAWNDQWSTRWNPAVFAEQGYVVITPNPRGSTGYGQEF
TDAIRGSWGGLPYIDLEKGFDYIEKNLKYVDTNRAVALGASYGGYMMNWI
QGQPLGRRFRALVTHDGVFSTTSLLATEELYFPLHDLKGVQWIVPENWAQ
WDPSRHLDKWQTPHLIIHNEKDYRLTIAEGLSAFNVLQMKGIDSAFLTFP
DENHWVLNPENALMWHYTIFNWINKHVGLPAASERFEQFSA
aspng-DPP5: Aspergillus niger, dipeptidyl peptidase V, 1 reference(s)Aspergillus niger Show
MGALQWLSITAAAASAVSALTPEQMIGAPRRTEVIPNPSGDTGLFSTSQW
SFDTHSESTWWSLIDLESGETTTLTDDSDIEEIIWLGSDSSTLLYINSTN
AQVPGGVELWIADSSDFANYKAASLSAGFLGIKSTVTDSGDVHFILRGKS
YPNGTAYNDQLAETYPSTARIYDSIFVRHWDTYLTTASHAVFSGTLQSST
SDDGNVQYTSSGGLTNLVNPVKGAESPFPPFGGNDDYDLSPDGKWVTFKS
KAPELPLANNTAAYVYLVPHDGSATAFAVNGPDSPATPEGVEGESNNPVF
SPDSDKIAYFQMATNTYESDRNVLYVYSIADDTITPLAKDWDRSPSSVTW
VDGDNLVVASQDLGRTRLFAIPGDAGTTSSPRTFTDGGSVSAQYVLSNST
LLVTSSAFWTSWSVYTASPDEGVINTLASANEIDPELSGLSSSDFEEFYF
DGNWTTLQGWITYPQDFDSSKKYPLAFLIHGGPEDAWADEWNLKWHSKVF
ADQGYVVVQPNPTGSTGFGQQLTDAIQLNWTAGAAYDDLTKAWQYVHDTY
DFIDTDNGVAAGPSFGAFMITWIQGDDFGRKFKALVSHDGPFIGDAWVET
DELWFVEHEFNGTFWQARDAFHNTDPSGPSRVLAYSTPQLVIHSDKDYRI
PVANGIGLFNTLQERGVPSRFLNFPDEDHWVTGQENSLVWYQQVLGWINR
YSGVGGSNPDAIALEDTVNPVVDLNP
aspor-q2urt4: Aspergillus oryzae dipeptidyl aminopeptidase, 1 reference(s)Aspergillus oryzae Show
MTIRPMKFTPEVLLGAPRRSAAVPNSSGTLAVYTQTSYSFESHAKTSEIR
VLDITTGRSSLITNDPSASSPQWLGNDDRLIWLKTKANGNTSFIVGHARE
AGKTYTAGTVPGPVANLKVTVIESGKIGFAVTGKANPDGSLHNPQDAKKP
HTTGRLYSSLYVRHWDSYIEPQTNSIWYGLLQQAPLTPATRHAGKYSTSA
LTNLISVCGLTGVESPIPPFGGSGDFDISPSAIVFVAKDPNENPATHTSC
SCYYCPMFSWTSVTAMESQKIYAVKGLQGAMSSPVLSSDGSSIALLAMRE
DGYESDKNRILYVPNPWSGEMIEAFASPDGEGLWHLSPSAVTFANDDQSL
LVQVEENGRGVLYQLPIANFRHSRPSALKKLTHSGYVTDVFPASANSSKL
LVASNSLVENSRWTIIDPQSPESPKVISSLSRGGAAFGLSPAQVDEIWFR
GAKDHPVHAWVVKPSDFKPGNKYPLAYLIHGGPQGAWNDQWSTRWNPAVF
AEQGYVVITPNPTGSTGYGQAFTDAIRGSWGGLPYIDLEKGLDYIEKNLD
YVDTTRAVALGASFGGYMVNWIQGHELGRRFKALVTHDGIFSMRSLLSTE
ELYFPVRDLQGPYWKVPENWDKWDPSRFTGNWQTPHLVIHNELDYRLTIA
EGLAAFNVLQMRGVDSQFLTFPDENHWVLNPENSLMWHRTIFNFINKYVG
LPSESRADLENGVANMSL
aspor-Q9Y8E3: Aspergillus oryzae Aspergillus flavus (strain ATCC 200026/FGSC A1120/NRRL 3357/ JC12722 / SRRC 167) alanyl dipeptidyl peptidaseAspergillus oryzae Show
MGALRWLSIAATASTALALNPEGLISAPRRSEAIPNPSGDVAVFSQSQYS
FKTHKTTSQWNVLDLKSGDIKLLTNDSDVSEIVWLGSDDSTVLYVNGTNA
DIPGGVELWVSDISDFANGYKAASLPASFSGFKVVTTDSGDVRYVAYAES
WANGTAYNEELVAKPLSSARIYDSIYVRHWDYYLTTRFNAVFSGTLKKSE
GKGKATYKADGDLKNLVSPVKNAESPYPPFGGASDYDLSPDGKWVAFKSK
AHDIPRANYTTAYIFLVPHDGSKTAVPINGPDSPGTPEGVKGDAGSPVFS
PDSKKIAYWQMADESYEADHRTLYVYTVGSEETIPSLAADWDRSLDSVKW
ADDDNLIIGVEDAGRSRLFSIPADAGDDYKPKNFTDGGVVSAYYQLPDST
YLVTSTAIWTSWNVYIASPEKGVIKTLATANKIDPELKGLGPEIVDEFYY
EGNWTKIQAFVIYPENFDKSKSYPLLYYIHGGPQSSWLDSWSTRWNPKVF
ADQGYVVVAPNPTGSSGFGDALQDAIQNQWGGYPYEDLVKGWEYVNENFD
FIDTDNGVAAGASYGGFMINWIQGSDLGRKFKALVSHDGTFVADAKVSTE
ELWFMQHEFNGTFWDNRENYRRWDPSAPERILKFSTPMLIIHSDLDYRLP
VSEGLSLFNILQERGVPSRFLNFPDENHWVQNKENSLVWHQQVLGWLNKY
SGVEESNEDAVSLDDTVIPVVDYNP
asptn-dpp5: Aspergillus terreus (strain NIH 2624 / FGSC A1156) Dipeptidyl-peptidase VAspergillus terreus Show
MAALRWLSAVVAVSTTVLAITPEQMLSAPRRGEAIPNPSGNVALFSASQY
SFDTKEKSSSWNLLNLKTGDITLLTDDANVSEIVWLGGDDTSLLYINGTN
AEIPGGVELWVSSVKDFSKGYKAASLGASFSGLKAVRTRSGDIKFAVNAQ
SYANGTAYNEELATKYASTARIYDSIYVRHWDTYLTTTFNAVFAGTLKKG
KHQYASAGPLKNLVAPVKNAESPYPPFGDSTDYDVSPDGKWVAFKSKAPD
VPRANYTTAYIYLAPHDGSSTATPINGPDSPGTPEGVQGDANYPVFSPDS
RHLAYFQMAHKSYESDRRVLYVYTLGSKTTTPAVAGDWNRSPDSAKWLDN
KHLILGSEDHARVRLFGPVPIDADDDFKPQNFTDGGAVSSYHVLPDKTVL
VTGTAIWTSWNVYTASPKKGVIKTIASANKIDPGLAGLGPEDISEFYYDG
NWTKIQSWIIYPENFDSSKKYPLFFYIHGGPQSATPDSWSTRWNAKVFAD
QGYVVVAPNPTGSTGFGQELTDAIANNWGGAPYEDLVKAWEYVDKNLPYV
DTENGVAAGASYGGFMINWIQGSDLGRKFKALVCHDGTFVADAKISTEEL
WFIEHDFNGTFWGARDNYRRWDPSAPERILQFSTPQLVIHSDQDYRLPVA
EGLAMFNVLQERGVPSRFLNFPDENHWVLKQENSLVWHQQMLGWLNRYSG
IEEANPDAVSLDDTIIPVVNYNP
bacld-q65m29: Bacillus licheniformis (strain DSM 13 / ATCC 14580) Bacillus sp. BT1B_CT2 hypothetical protein (putative amine dehydrogenase), 2 reference(s)Bacillus licheniformis Show
MEKADSILHALRIKDFAVHPDETQLIFDTNLNGTSNLWAMDLPDTYPYQL
SFLNQDSKGIAYNPDGSILYAGFDNDGNEQSGLYKLSLKNGTFQSLNGNQ
TDRHFAPIPVQNAVYYSSTKDNPTFLNTYRYDCLTEKEELIFEGKDGTSM
LSDVSPGEKAVSIHVYYVNSHSVCMVHTAEGVTTGIFPDETLPHMVYSSH
FASDDRLFVTTNYEAEFSYLALYTVSSGIFTPVLSIDKTDLTSIHADPNG
TFLYLIGKKGVKEVMYEYNTATGQSRQIDCPCTSISKIHCAYSGTLYILG
STPTRPTNLYVLTKGQSKWRQLTKHSVPGFSEQELSYPEVVTYPSFDGLP
IEGLLFKPSPVEANGWTIIWPHGGPQDAETFMFYDLFQLAAKMGYQLFAP
NFRGSANYGYSFFKMVEQDWGDGPRLDMTAGIDWLIDQKLADREKLFLMG
GSYGGYMSLLLHGRHPEYFRAVVDICGVSNLFSFVKTVPDFWQPMMEKWV
GNPERDYEKMKADSPVTYLENMTQPMLIIQGANDPRVVKEESDQVVDQLR
NMERNIEYLVLENEGHGFSKKENKMKVYRAIFEFFEKHRLYHAAKVEE
9baci-q2bdj8: Bacillus sp. NRRL B-14911 acylamino-acid-releasing enzymeBacillus sp. NRRL B-14911 Show
MLTFSKPDVEYFFQTFGIQTFAVSPDESQLVFSTNLNGKYNLWAMDLPNQ
FPYPLSFQNQSCQEIEYDKEGRFLLAVIDSDGDENGQVYALPRNGGELKP
IRTQENARHMGLIASKDGKTLYYTSSKEDATFLKAYAYNMETGEEKVLLH
GRGAATFLTAKSPDEKRFVFGRMFANTYSLAYAWDGEKEVLLTPEAEPQH
TVTDAVFTSENDIYLVTNYKEDLSYLAKFSLETNEFTKMLSLDGEDFSGL
KYDKKARTLYISSQKGAEDHLYRYGLEEGKAEQLELPASTIDGLSVAESG
NLYLLGRSAVTPPNLYKYAKGEWTQLTNNLVPGVSEEEMAEPEILHYPSY
DGLEIEALFFRAKEGNSNGHVILWPHGGPQAAERASFRSLFQFLVHRGYS
IFAPNFRGSSGYGLSYMKMVEGDWGYGPRLDNVEGLEWLIKNGYADREKL
LLMGGSYGGYMALLLHGRHPEYFKAVVDIFGPSDLFSFIESVPEHWKPVM
NQWVGDPVKDKEKLIEYSPITYLDTMTKPMLVIQGAKDPRVVKAESDKIV
AALQEKGREVEYLVLDDEGHGFSKKDNEIKVYRKVLEFFDGFIN
9baci-q2bf04: Bacillus sp. NRRL B-14911 prolyl oligopeptidase family proteinBacillus sp. NRRL B-14911 Show
METLTIENFMNIRNVKNPAYGPQGKMLNFISDASGIPQLWEIHAEGGNPN
QVLETAERIMFVSFIQGTGKRIFGMDEGVNEKQQLFLLTETGEVIRLTDS
PEHIHKYGGVSPDGKWISWASNRRHNTYFDIYIQSLESFEVKMVFQGDGH
FSPLQWHPEGNSLLIEQVNTNLDNDLGLLDLSGGTVQWLTKHEGEAAFAS
PAFSSDGKMIYMLSNRDREFMNLARLNLETLETKWLVEKEWDLEELKLST
DKKKIAFSINEGGVSKGALLDFESNEVTEWESPAGVITDFSFSPDNSRLA
FILNGPQHPSDIWELDLRSRKAKRATFISHDPLVEEKLCAPELISFASFD
GLEIPAFYYKPKKADGKLPVVVFVHGGPESQIRAVFNPFLQFFLDNGFAV
CTPNVRGSTGYGKSFTHLDDVRKRMDSVRDLVHLVDWLKTEGGAAEDQIS
IMGRSYGGFMVLAAITHYPDIWSSAIDIVGISSFRTFLQNTSPWRRKMRE
AEYGSIENDGAFFDEIDPLHKTDRIQCPLLVLHGANDPRVPIEETEQIVE
DLKNRKHPVEYIRFEDEGHFFVKRENNIKAYTASWDFLKEYSGRIKH
bacfr-q64t24: Bacteroides fragilis, Bacteroides sp., putative peptidase, 2 reference(s)Bacteroides fragilis Show
MRQVNLFIMSAAMMLASCGGTKDAGKTDQALIGKSDIKIEGKRMTPEALW
AMGRIGGLAVSPDGKQIAYTVAYYSVPENKSNREVFVMNADGTDNRQITH
TPYQENEVTWAADGSKLLFLSNDNGSSQLYEMNPDGSGRKQISKYDGDIE
GYSISPDGKKILFIAQVKTVKSTADKYPDLDKATGIIITDLMYKHWDEWV
TTAPHPFIADFDGKSISNIIDVLEGEPYESPMKPWGGIEQLAWNTTSDKV
AYTCRKKTGLAYAISTNSDIYVYDLNTKKTVNITEGMMGYDTNPQYSPDG
KSIAWQSMERDGYEADQNRLFVMNLETGEKRFVSKAFDSNVDAFIWSRDA
KTIYFTGVWHGETQIYSLDLANDSVRPVTSGMYDYEGVALFGDKLIAKRH
SMSMGDEIYAIALDGQTTQLTQENKQIYDQIEMGKVEGRWMKTTDSKEML
TWVIYPPQFDPNKKYPTLLFCEGGPQSPVSQFWSYRWNMQIMAANGYIVV
APNRRGLPGFGLEWNEAISGDYGGQCMKDYFTAIDEMAKEPFVDSDRLGC
VGASFGGFSVYWLAGHHDKRFKAFIAHDGIFNMEMQYLETEEKWFANWDM
GGAYWEKQNPTAQRTFANSPHLFVEKWDTPILCIHGEKDYRILANQAMAA
FDAAVMRGVPAELLIYPDENHWVLKPQNGVLWQRTFFEWLDQWLKPNETA
QK
bactn-BT0587: Bacteroides thetaiotaomicron B. caccae, B. sp. B. eggerthii, B. finegoldii, B. ovatus, B. xylanisolvens, B. stercoris, B. cellulosilyticus, B. uniformis , B. intestinalis, prolyl oligopeptidase family protein, 1 reference(s)Bacteroides thetaiotaomicron Show
MRQANLFMMSAAMLLAACGGTKDAGKTDQVLIEKSDIKIEGKRMTPEALW
AMGRIGGLAVSPDGKKIAYTVAYYSVPENKSNREVFVMNADGSDNRQITR
TPYQENEVTWIKGGSKLAFLSNDNGSSQLYEMNPDGSGRKQLTNYDGDIE
GYSISPDGKKLLFISQVKTKESTADKYPDLPKATGIIVTDLMYKHWDEWV
TTAPHPFVADFDGNGISNIVDILEGEPYESPMKPWGGIEQLAWNTTSDKV
AYTCRKKTGLEYAVSTNSDIYVYDLNTKKTDNITEENKGYDTNPQYSPDG
KYIAWQSMERDGYEADLNRLFIMNLETGEKRFVSKAFESNVDAFVWGNDA
KTIYFTGVWHGETQIYSLDLTNDSVKAITSGMYDYEGVALFGDKLIAKRH
SMSMGDEIYAVALDGSATQLTQENKEIYDQLEMGKVEGRWMKTTDG