Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: UCP037442

UCP037442


Genes:Proteins in UCP037442 (170)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9acto-d3d836: Frankia sp. EUN1f Alpha/beta hydrolase fold proteinFrankia sp. EUN1f Show
MATTESTASSPSQAPAQASAQGSSAEKVAVPVGGGVTLGLRIMAQADPAV
PVVALLPAMALKAKFYVPLAKALFGAGLSVVLCDQRGYGDSTPGLREQPN
FGYRELIEVDVPAVVTAIRARFPEAPLYLFGHSLGGQLALFHAASAPAGV
AGIITIGTGTPYWRAFGRRNWLEAYWKIQTIGLVARLRGHWPGGMLIGGA
MSGQVMVDWARQSRTSWCRPRGSSRRHDDALRALSLPVLAISLDDDRLGP
ASNVDFLCSRMPASRLTRWHVVAASGVENRDHFAWIKDSAVIGKAAATWI
TSGRLPAAATAGSGTGTGPTDGGDR
9acto-d3m9d3: Frankia symbiont of Datisca glomerata Alpha/beta hydrolase fold proteinFrankia symbiont of Datisca glomerata Show
MSVRGTDRNAATDGPAVQPSELAAPEAIHVTTDDNVTFVIRLLEHDDPTA
PVVLILPAMGMKAKFYRPLAKALFTAGLSAATCDLRAQGESTPSLREQPN
FGYRELLEVDLPTVLAALRARLPQAPVYLFGHSLGGQLALLYTASASKEI
AGACVIATSSVYWRSFAPRRRLVALWQGQIIGLVSRIRGYWPGGMVIPAP
MAGGVMTDWARHIRNGRYQPRGSGRDYNEALRTFDLPVLVISIAGDPLGP
RPNVDFLCGRMRGAQVTRWHVEDGSGVIVNDHFAWIKSSGIIGSATAAWI
TGGALPTGT
9acto-d9wqe7: Streptomyces himastatinicus ATCC 53653 Alpha/beta hydrolase fold proteinStreptomyces himastatinicus ATCC 53653 Show
MTTSSKSDERPSEFGALEELRLTTPDGAGFVIRLLPHQDPAAPVVLMLPA
MAMKAKFYLPMAKALAAAGCSVATVDLRAQGESTPKLGDAPNFGYRELLE
VDMPAIVDAVGARFPQAPLHLFGHSLGGQVALLFSATAPHRVSSVTIIGT
GSVYWKAFERRRWFEALWKIQWIGLVARFTGRWPGGVLIPGAMQGRVMAD
WSRHSLTSHYRPRGGSYDYDRKLAALKLPVLAISLDEDPLGPKSNVDFLC
GRAATADITRWHIDASSAVVHRDHFQWIKDSTVIGPRIAGWLRDGQPPR
9acto-e6j6x5: Dietzia cinnamea P4 Putative uncharacterized proteinDietzia cinnamea P4 Show
MTTIEDPARVELRHPDGSTSPLLIVETDRRDERRPSVLVLPGIAVGARYY
LPLARALAAEGVDVAITELRGQGESTYRIGRRGAPAGYHESAAEDVPLAL
DAMERRLGRRPVILLGHSMGAQIGVYHLARHDPRVAGLVAVAAQSPFHRG
FPGPVGRKLRAGSVILPALGWLSGHVPGQFFGAKGRIPADRIRDWARLAA
AGVMQPARADLDYPAGLARVTVPALAVVIADDPLAPASAARNLLAMLPSA
RTTLELEPEALGHNSWARRPAEVVARVLAWTDREVVRPEGDDDEVVDA
9alte-a6ezs0: Marinobacter algicola DG893 Alpha/beta hydrolase fold proteinMarinobacter algicola DG893 Show
MMEKTIITCDDGYRLTGHFFRPATDVPRGAVLIAPATGFRHQVYFIFATW
LSEQGFAVLTFSNRGIGDSRNGIPLAEISSDLVDWGTLDLPAALEKLVAL
APGLPVSLVGHSAGAQLIGLMPNFAQIDSYVLIAASSGHFDNLKLKTKLA
AKLLFHGWQPLSVAVKGYWPTKIIGFGEDLPAGVARQWRQWCRSPGYVEN
SFGEEIRQHHYADIKAPVLSLTATDDHIAVPANVEDFLRLLPNAQIKKHF
LEPGSFGLKKIGHSDLLRSRCKACWPHILEGLESNG
9alte-a6f258: Marinobacter algicola DG893 Putative uncharacterized proteinMarinobacter algicola DG893 Show
MSARESSLPPTNRKDVPVTTPGGHRIQLRVFPADQSSSVVIVAGAMGVGQ
HCYEKFARYLSSQGFTAITFDYFGMGASLNGHLRDCPVKVTEWGSEDCRA
VIDFARQHYPGQRLQWIGHSVGGQLLGMTPNVNDLDHAVTVACGSGYWRE
NSPPTKRIAWFLWYFMAPVCVRMVGYFPGKRLNIVGDLPPNVIRQWRQWC
LDPEYAVGKEGQALREQFAAVQVPISAVAFTDDEMMSRRNVDSLHSFYTR
AAVTMHRVDPKDIGEHRIGHLGWFREQYEMSIWRNTLLPLLR
9bact-a1zf48: Microscilla marina ATCC 23134 Alpha/beta hydrolaseMicroscilla marina ATCC 23134 Show
MQELKITTPDGHPLAVTSFNPAGAPKAVVMINSAMGVLRQYYNKFAAFLA
NEGFQVYSYDYRGIGGSSPKSLRGFEASIHQWGIVDVNTMIEYATVQHPN
LPLTAIGHSVGGQALGLAPSCQKVQAIMLVASQVGNWAYWDKGRTKLKFF
WKYMLPYLAKLFGYFPAKKLGMFENLPKGVAIEWSQWGSHPDYLFAYDFE
VPKQHSELEVPLLSWSFTDDGYAPIRAVKALLNRYNKADITHRHLAPQDL
GVNRIDHFGFFREKFKDSLWADSVEWLNAQVVIQA
9brad-d6v1d6: Afipia sp. 1NLS2 Alpha/beta hydrolase fold proteinAfipia sp. 1NLS2 Show
MTVESGNIVRIVCDDDVVLGGHVWRGATPVCGAVAINCATGVLASYYHYY
ARFLADRGFVVLTYDYRGIGMSRPERLRGCGYRWRDWGEKDFDAALQFLH
QQAPNLPLHVVGHSFGGYLPGLAGHAALIDRMLTVGAQYAYWRDYAARRR
AALFLKWHVVMPAMTALCGYFPGRRLGWLEDLPAGVANEWSFRRARMEMG
HPRRQRMEVQRRFAAVNARIVAICVEDDELGTPAAIRRSLAYYKNAKVME
AALTPADYGCDRIGHFGLFHARHSGDFWLDTLLWLRDGINPWPDRRFRCD
AGV
9burk-a2w8w8: Burkholderia dolosa AUO158 Putative uncharacterized proteinBurkholderia dolosa AUO158 Show
MTMSDQNEAGGALRDDRTAGMLPEPVTLRAADGYALRGHVWRHRGGGAGR
PVTVVNCATSVRCDYYFRFATWLFAHGRDVLVYDYRGIGGSRPARLATLR
ATWLDWGRLDCDAALQYARDAFPGQPVDVVAHSIGGCVLGLAQSNAYVRH
AVTVGAQYAYWRDYLTAERRRMWCKWHVAMPALAAAFGYVPAKRLGWMED
TPRGIALSWARSQPRFEDTYARGWLAESSAERMALPARFARLSAPMLAIG
IDDDAFGTVAAIERLTGYYTGSDVTHLRIAPADIGVDAIGHFAFFHSRFA
DTLWPVALHWLQHGALPAAAPGIVHARHPAQRGRRDGSAADVVASA
9burk-a2wf36: Burkholderia dolosa AUO158 Putative uncharacterized proteinBurkholderia dolosa AUO158 Show
MQRCKYFMNATVGNGSVERSRKRQWKDSSIDISCAKYTGVYISHTKQLDE
TRTDMTAEPIEFPAADGYALRGTLWSPRAAPRALVLIHPATAVPERLYAA
FACFLTERDFAALTYDYRGIGASRPARLSALHARMRDWVDLDVEAATAWA
RHTFDGVPLLAVGHSVGGHAIGLSAASAHLHAAVLVASHAGSTRLIEHAA
ERLKVRLILRVLGPLACALLGYVPGKRLGLGEDLPAGVFREWSDWTTLPR
YFFDDPTLGAAERFAKQRLPILVLGFDDDPWANPAAIDLLVSYLTGAAVE
RRQIDPRATGSGPLGHMGFFRSRCGSVLWPGVADWLARSLDLPRNDDRPS
LSIAAGNQA
9burk-a6gnt2: Limnobacter sp. MED105 Alpha/beta hydrolase fold proteinLimnobacter sp. MED105 Show
MINTIEVCIPAAGQSLAATFFPAAGGSHDKPVLICPATGIIQKFYFPFAR
WLAGQGFSVMVFDYRGIGKSLQESHVKHCPVKKQDWGLYDMPAALDFLLE
LTGQRSAYLIGHSAGGQLFGLMHNHAKVRGVLAVAASSGHVKNIRKDKRN
SARFMLRWVIPVSSALLGYVPAKRFGWGENLPKGVGLQWAKWCSSPGYVE
NEFGEGVQQHWFEQFSSPITFVHASDDEIATLVNVEDIMRLFTKASKKRL
EIKPEMFKLGKVGHIDIFRERCNSIWPQILAELTPAH
9burk-c9ya28: Curvibacter putative symbiont of Hydra magnipapillata Putative uncharacterized protein, 1 reference(s)Curvibacter putative symbiont of Hydra magnipapillata Show
MNSQLAMKAHQPMNTPESLTLTTRDGYTLQALRYTAVGPLRGHLVVAGAT
GVPQLFYKNFALFAAQQGYTTLTVDYRGIGLSKPAALRGFQMDYLDWAFH
DVAAAVDAMADDTVPLFMVGHSFGGHAFGLLPNHDKVARFYTFATGAGWH
GWMPRAEQFKVLLMWHVIGPLLTRWKGYLAWSKLQMGEDLPLGVYRDWKR
WCKFPRYFFDDPGMPHVAGLFGRVRTPIIAANATDDLWAPPASRDAFMAA
YSNTTVSKVDIHPGQQGIGPIGHMGYFRKQAQPLWSDVLRWFGEHQTSR
9burk-q27ip7: Burkholderia cenocepacia (strains hlpa; AU 1054; HI2424; MC0-3; PC184; J2315/LMG16656) hypothetical proteinBurkholderia cenocepacia Show
MTISNEAGGAAAQGSRAAGALPPEPVTLRAADGYALRGHVWRHRGGGAVR
PVTVINCATSVRCDYYFRFAAWLFAQGRDVLVYDYRGIGESRPAQLAKLR
ANWLDWGRLDCEAALHYARDAFPGQPLDVVAHSIGGCVLGLAPSNVHVRH
AVTVGAQYAYWRDYLPAERRRMWWKWHVAMPALAAVFGYVPAKRLGWMED
TPRGIALSWARSQPRFEDGYIGRELDDSGASRAALPARFAGLSAPMLAIG
LDDDAFGTVDAIERLVGYYTGSNVTHLRIAPADIGVDAIGHFAFFHSRFT
DTLWPVALYWLQHGVLPADAPGAVHALHPASRGRVTGSGVPGRAANG
9caul-b4wag9: Brevundimonas sp. BAL3 Putative uncharacterized proteinBrevundimonas sp. BAL3 Show
MGRAVEDRVIKALDGWPLEATLFRGDAPRMAVLVSAGTGFPRGFYARFAR
WMAERGCVVLTYDYRGIGGSRPEDLAAMEMDYPDWGRLDMPAALKALKKA
APGLPIFHVGHSVGGHFVGFMPNQAEIGRHAFVSVGTGWWGGHHRTYNPI
ELFFWFGFGPHHLRRHGYVRAGRLWRGTDLPRGVFETWKRWCLKPSYFLD
ELKSGALEPQGFDAVRAPIRSWIFPDDPIATPGTGAALLKAYPNAPSEVV
VRDGPDYGVRRVGHEGAFRKGLEPLWQEILDWFDAGVTKTGAGA
9cory-c0xti5: Corynebacterium lipophiloflavum DSM 44291 Alpha/beta hydrolaseCorynebacterium lipophiloflavum DSM 44291 Show
MANNVDITLPDNSTSTVALYPAPNSGKPLVVIWPGFGMGARYYRPIAEWL
AERGFPAAVGELRGQGTSTAVASRNQSWSYHTMATEDYPLTITAAKDSLG
LPHDHPVIFLTHSMGGQIGTLFFANSVAQELNVLGLMGVGTGSPYFKTFN
PATKRRLFVGARLMAAVSRVLGYWPDGPLDIAGYGRQSGKHVGEWARLSR
TNLVDHIDGNDYTNALLDVTAPVLYTRFNNDEDCTIASAEALAEHIPTAH
PKVEELSGDLGHNRWAREPEIVGRRFVRFYEENFA
9cory-d7w942: Corynebacterium genitalium ATCC 33030 Putative uncharacterized proteinCorynebacterium genitalium ATCC 33030 Show
MTSVDEHYTLSYLPDHSVSTVYCFEPKEPRAGAPLVMMWPGFGMGARYYR
PLAKELASRGYYVAIGELRGQGTNTTKAMPDNQWGYHNLASEDYPEGIKA
AKKELSLQPNHPTYLLTHSMGGQVGSMFLARPEAKELNVQGLMGVGSGSP
YHRGFTGKDHVRALLGGQMMGQVAKLRGVWPGGALDIAGYGRQSGRHVYE
WSRFSRMNTIADLQGQDINYAEEIKNVRVPVLLTRFANDSECTLESCEYL
LEHLEKAPRKAEELPGRLGHNRWAREPGIVADRFEEFVAQQI
9cory-e2mwc9: Corynebacterium amycolatum SK46 Putative uncharacterized proteinCorynebacterium amycolatum SK46 Show
MPETKHRTEPASITCSDGVALAGQWVLPLTDESSVTKAIALHPATGVDMN
LYRKFAIYLAEHGWPALIYDFRGTGESATGDAKRDRTIRMSDWILYDVPA
ATAALKERFPNAKRVAIGHSVGAHGMLATQAEEPVDAMAMIASHAGITRT
VKTAAERAKVWTIFNIVSPVCSRLLGYVPIDSLGIGKIIPVGVMTQWSTW
TRKPGYFFADPEFNLAERFKQATGPLLSVVFTDDLWANRPAVDVLTDQAV
QCDVVKRDIEAGEGTKNGPIGHMGFYRSKNRALWPEVAAWVEAA
9cory-e2myg3: Corynebacterium amycolatum SK46 Putative uncharacterized proteinCorynebacterium amycolatum SK46 Show
MVNGEPPVEPRIVQETLPDGSVTPMALRTPEGTPRGIVIIWPGFGMGARY
YRPIAQELQRRGFCVLTSELRGQGNQTAVSTRRHNWGYQDLASVDYPLAV
ARARKEFDQLAVGEATGEKLPVYLLCHSMGGQIASLYLARPEADVAGVVM
VGSGTPHYKCFTGNEYKRLRYGAPFMQVVSQILGYWPAGRFDVAGYGRQA
RNHVVEWARFSRTGLLRPRGADIDYATEMPKVTTPALLLNCGGDRDCPAE
SAQALARMLPNSAKYEFIEQRLGHNRWAREPQAVVDRLEQFIEEI
9entr-d4bbc1: Citrobacter youngae ATCC 29220 Alpha/beta hydrolase family proteinCitrobacter youngae ATCC 29220 Show
MNSIIIPVNQGGFLAATVWERSNAKAMVIIHPATAVVQAFYKGFAEYLFS
RGFSVLTYDYRGTGLSKSGRVCHYSVSMSDWIEQDVGCITTWAKAHFPGV
SLLAVGHSVGGHAVLLSSATQALQAAVIVASHAGVTSTIKRTVEKVRVWC
LLRVLAPVLCRIFGYMPARRLGLGEDLPAPVMRQWGKWSAMPGYFYDDPD
WNARQRAGEITLPVLVMGFDDDPWANPEAIARLLEPVQNAKIECREIRRA
DFGLSSIGHMGFFRARCAEKLWPVVGQWLESQCPD
9flao-a8ugq1: Flavobacteriales bacterium ALC-1 Putative hydrolaseFlavobacteriales bacterium ALC-1 Show
MSKPLDILINTPLGHDLGLTLFKPKTSNNKSLVISSATGVLQHYYYKFAI
YLSKLGYTVYTFDYYGIGKSNSNIDALKKNIINLKCWGENDQASVIDYAK
AQNQKHEIIAITHSIGGQILAFNKSISKIDAIITVASQSGYWKHWKGYER
IRMFAFWHLMIPLLTPVFGYFPAKKMKLFENLPKQMVYQWMRWGKHKDYM
LSEFDFKNLEFKNYNKRLLVLSFPRDEYASKSSVDWLAKLFNNSNIDRRH
IIPEDIGIENVGHFGFFRSKFEDSLWKMTHEWIIAN
9flao-d7w4n0: Chryseobacterium gleum ATCC 35910 Putative uncharacterized proteinChryseobacterium gleum ATCC 35910 Show
MSTFIVDFFFYTMEKLILTTEDHISLTAHLFKPQKDNGKLLLINSATGVK
QQVYFSFASYFAEQGFTVITYDYRGIGLSKPKNMRGFHGSMRIWGSKDYK
AVTQYIKTNFKEYKKYCLGHSVGALILGMNKDSEMFEEFFFVGTQNAFVG
NLRGITKVEAYLGFGIAQPVTTSLLGYFPAHWFGLGESLPKNCAYDWRTL
ILNRKSTNRLLEKIDNFSKNLTQKVFVVRAEDDIWLTEKGVLSLLNNTYP
NLKPTYRLIAVSESDKKEIGHINFFRSYNSKLWDIILNELTDK
9gamm-a0y0v4: Alteromonadales bacterium TW-7 putative uncharacterized proteinAlteromonadales bacterium TW-7 Show
MATPHFDHITITCNNRQTLSAHVFKPEGTIKGAVMIAPATGIKQQFYANF
ATYLQQNGFAVITFDNSGIGQSLKGSIKNSKANLQSWGEQDMPAVLEQLQ
KTFPNTHYHLIGHSAGGQLVGLMHNATQLSSLFNFACSSGKLTNMRLAYQ
VKAHFFMNGVIPVSNALFGHTKSQWFGMGEPLPKGVAQQWQKWCNAQGYV
KSAFGNTVFQHFYNELAMPSLWINASDDDIANNDNVADMLSVFPKLNAQT
LHLTPSEYNLKDIGHMKFFSKRSAALWPLALDWLNKHSI
9gamm-a3wnc0: Idiomarina baltica OS145 Predicted dehydrogenaseIdiomarina baltica OS145 Show
MQSTRLKYANRALAINYFPAAGAQQHVVIAPALGVKQRFYHRFAQWLAEQ
GIAVTCFDYYGIGDSIDKPLSKIETDIIDWATLDLDNVLTWAQEQLPSAE
LIWLGHSLGGQLLGLIPHPERIDRIVTVASGTGYWRQASSQVRRTSWLLW
YLAIPLATPIAGYFPGKRLNMVGDMPAQAMRQWSRWCRSRNYLFDHLSTA
QLKGYQRLTQSYHAFAISDDELLVEDNVRALLQRYPNTQQKLTHLTPQQA
GRRIGHFNIFKPTHQQTLWQKALLPAIKADQTARLVTEEN
9gamm-a3ybw0: Marinomonas sp. MED121 Putative uncharacterized proteinMarinomonas sp. MED121 Show
MMETKILETTAGHSITAQIFSPQGESKGVCIIATATGVAQHLYNDFANWL
TEHNYTAVTFDYDGIGQSIDRHVKYCKSDKLSWAKHDCPTVLNFVKHAYP
EQKITWIGHSVGAHMLGFMEDTHAIDKAITVGAGTGTWWYNAKPTKRAAW
FLWYFLVPIVVPLMGYFPGDKLKIMCNLPKGVIMQWRRWCLKEDYAIGYE
GDWLKERFANTKMPITAFAFSDDDMMSMKNITMLHSFFTGSKQSMVKITP
SDIGQKRIGHIGWHKERYRTLWDKYFLNALES
9gamm-a6fd16: Moritella sp. PE36 Putative uncharacterized proteinMoritella sp. PE36 Show
MINTIEISTLDGYQLVASEFKPDKSNGRVVIINGATGVLRKYYQPYAEFL
CAQGFTIITYDYRGIGDSKQASVNAKPASMIHWGQLDMDAVLTWTQSHYP
EMKMSGVGHSIGGQLLGITPNNNRYESFLNIAAQQIHWKNWARKDQPLSV
LFFYCVLPLFYSVNKGLPKWVLGAEYLPKQVIRDWSRFGRKPFYTDEQGN
ELHDGYHRYTGNMRFYAMADDNRFAPPSCVKVLQQHFKNAPSDMIVVDPK
QVGMRSIDHFGFFKRSMSESVWQDTSNWLASSS
9gamm-a6fhh8: Moritella sp. PE36 Putative uncharacterized proteinMoritella sp. PE36 Show
MDNFFTDEVDVYCQDGYKLSATLFKPTTAVKAAILLAPATGITQQFYKGF
ACFLVEHGYAVITFDNRGIGKSLSGKVSASTASLQCWGEQDMPAVLEFLK
TTYPDNSYHLIGHSAGGQLVGLMHNAKDLSSIFTFASSSGRLKNMKMPYA
FKAHFFMNFFIPMSNLLFGHTKSQLLGMGEPLPKGVAQQWRQWCNGQGYV
KTAFGKSIHKHLYDTLSMPSLWVNASDDDIAIDVNVTDMLTVFKNMNAET
MTLSPEACNLSEIGHMKFFSRKAKHLWEYPLTWLENNVPPAVNSRR
9gamm-a6fjk3: Moritella sp. PE36 Predicted dehydrogenaseMoritella sp. PE36 Show
MLIVMITKHSVICSDKTSIVTTLYDSATPKGTIIIASAIGVKQDYYARLA
VFLSENSFNVITFDYRATGESQSEKNGVALCSQLSDWGEKDIEAVIEFSE
GRGLPVYFIGHSIGGQILGLSKSAVNLKKIIFIASSAPYWRRWAFPDNIK
ILLTANVVFPFISYIRSDFPTKSLGLGNQNIPSTLIRQWAKWMSASDYLF
SEKFNLNLSGYQEITQDLLSIGFTDDNLAPENNIRELLSFFPNSNSDVKL
IDPKEVNASKIGHVGFFNDKFKHNLWEDILLWLKQENN
9gamm-c0vkv1: Acinetobacter sp. ATCC 27244 Acinetobacter haemolyticus ATCC 19194 Alpha/beta hydrolaseAcinetobacter haemolyticus Show
MKTFESFWISCKDGYQLAAQFYPAQQKDINALPILICPATGITKTFYHAF
AEWLSQQGYNVLSFDFRGIGESLHGALKDSTASINDWGMLDIPAAIETLL
KRTNAEKVIIVGHSAGGQLLGITPNYHKVAKVLAIAGSTGHIKGLKGKTK
LLAPVMFNVIFPISSLFKGYGATQFIGMGENLPKNVAKQWAEFCSKPGYV
MNAVGKSIFEDYHQEIQCPITSFWASDDEIATHTNVKDLLRLYPNAKTKL
VELNPQKHGYKQIGHMLMFKKSHQKLWSLIENELHI
9gamm-c8q1e6: Enhydrobacter aerosaccus SK60 Alpha/beta hydrolaseEnhydrobacter aerosaccus SK60 Show
MSNLTLKTPSALASAPTQQTIQIPTKHPATLAATVFRPDTVKAAVMIAPA
TGIKRQFYQNFAQYLMDHGYGVISYDNEDIGESMQGNLKHSNASLISWGR
YDMTAVLDRLIQEFPNTTYHLVGHSAGGLLFGLMPNHDKLTSVFNVACSS
GQIRNMAMPYRAKAMWFMDVFIPVSNVLFGYTQSSKIGMGEDLPKNVAKQ
CRDWCNGAGYIKTAFGKTVKTHYYNKVNLPAMWVNAPDDDIANDKNVADM
IRVFPNMQATTQTLKPKDYGLQHIGHMKFFSRQNQPLWQQTLDWLHQHG
9gamm-q1n5r4: Bermanella marisrubri Alpha/beta hydrolaseBermanella marisrubri Show
MEKTLIACQDGYCLTGHFFKASTDTPRGAVLIAPATGFRHQVYFNFASWL
SEQGFSVLTFSNRGIGDSRNNTPLAQISGDLVDWGSLDLPAALEKLINLE
PDLPISFVGHSAGAQLIGLMPNFSIVDRYVLIAASSGYFNNLKPKTKLAA
KLLFHVWQPISVAFKGYWPTKIIGFGENLPRGVAKQWREWCRAPGYVENS
FGKEIQQHYYADIKAPILSLTATDDHIAVPDNVDDFLRLLPNASIEKHFL
EPAGFGLKEIGHSDLLRRRCEACWPTILNGLAS
9mico-a3tp75: Janibacter sp. HTCC2649 Putative hydrolase, 1 reference(s)Janibacter sp. HTCC2649 Show
MDHVTDLDLPGGGHTAIVGVDGGGPGDPVVILLPALGVAAGYYGPFAAAL
AAEGVAVLSADFPGQGVSRPLASRKNDFGYAAVSDDVVAATVAVAQERHA
GRPLAFLGHSFGGQVALVHLATHASPVSALVLIGSGSPYWRGFPNRLKLL
VQTQTLGAIASVRGHWPGDRVGFGGRQPRKLMREWARFARRGDLAVERGE
VVGEPDFSGVGLPVLAITLDNDALAPQGSVDNLAGKLTGARVEHRFVTRA
AGEDGPAFDHFTWVRHPGSFAAEVAVWLRDAVSR
9mico-e3ba94: Dermacoccus sp. Ellin185 Putative uncharacterized proteinDermacoccus sp. Ellin185 Show
MHSTTALEATVTTTSGLTSHVTFIPVDDPAAPVLVIRPAFGAPASYYRHL
TQALAEAGLASLVVEYPGRETRDGIGRETTYGYDALATGVHESVVTHVRE
LRPDAPVVLLGHSLGGHVSIFAAALHPDGPAAVDGVILAASASPYWRGYG
APGRVRSFAGTALMATVARAVGYWPGDRLKFWGRQSRVLVQDWSRMARTG
RVRPSGAQIDYEAALGAYGGQVLAISLPNDSFAPVGGLEQMLRWVPKARV
TRWHSPDDLGHIQWVRRNADVVPVIAAWVEENIAAR
9prot-d5rng9: Roseomonas cervicalis ATCC 49957 Alpha/beta hydrolaseRoseomonas cervicalis ATCC 49957 Show
MTSGVAPRPLRLVAADGVPLGATLWPAAPGAMAGPVVVISPATSVRARYY
GRFAAWLAAQGLDTLTFDYRGIGESRPARLRGFRAGWADWGELDLEAALR
CALEHFPGRELALVGHSIGGLALGLAPSAGRAARLLSVGAQYAYWRDYAA
RERPRMLLKWHVAMPALTALFGYFPARRLGWMEDTPAGVARDWSRMGARL
EDQLRDGAALKARLGGVTAPLLAISLADDPHGTPAAVERLLAYFSACPRH
RLHLDPVARGLGRVGHFAFFHSRFAATLWPLARDWLAAGRLPPGATPWPA
PPASQPG
9rals-e2sut4: Ralstonia sp. 5_7_47FAA Alpha/beta hydrolase family proteinRalstonia sp. 5_7_47FAA Show
MDSTPHTIPATDGYPLGAMLWTAAGVPHGVVVMHPATGVPQRIYQAFAKF
LAERGFHTITYDYRGIGASRPKSLRRFAARMRDWALLDAEGVMRWARARY
PELPHLAVGHSVGGHAIGLCSADWDVAGVVQVACHTGNARFIRQRGERWR
VDLILRGVGPLMARLIGYVPGKRMGLGEDLPGGVAIEWGAWAGMQRYFFD
DPTLGAIERFNRVTHPVLVYGFDDDPWATPAAINALTMHFTNTWVERRQI
TPAQAGGAVGHMGFFRAQFATTLWPDLVDWLRERAATTCNEAEAA
9rhob-a3sdx6: Sulfitobacter sp. EE-36 Alpha/beta hydrolaseSulfitobacter sp. EE-36 Show
MTDDITQTTIRFAATDGWELEADIHTSSSPKIAVLTSAGTGFPRQFYTGL
AMYLARQGAVVLTYDYRGIGGSKGKDLAGSGIDYPDWGRLDAPAALNALE
EAAPGLPLTHLCHSVGGHFVGLMPNHSKITRHAFVSVGTGFFGGHHLRNI
PSELYFWWVLGPYLLLRYGYIKPAGGWRGEALPPKLFKTWRRWSQRRSYF
QPDLATKLAPHHYDEVTAPIRSWIFPDDPIATPSTASDLLKCYRAAPHEV
IIRTPSQVGVTRIGHEGALRKGRDALWAEFSDWLMGAP
9rhob-a3szm7: Sulfitobacter sp. NAS-14.1 Alpha/beta hydrolaseSulfitobacter sp. NAS-14.1 Show
MTEDITQTTIRFAASDGWELEADIHTSPSPKIAVLISAGTGFPRQFYTGL
AMYLARQGAVVLTYDYRGIGGSKGKDLAGSGIDYPDWERLDAPAALNALE
EAAPGLPLTHLCHSVGGHFVGLMPNQSKITRHAFVSVGTGFFGGHHLRNI
PSELYFWWVLGPYLLLRYGYIKPAGGWRGEALPPKLFKTWRRWSQRRSYF
QPDLATKLAPHHYDEVTAPIRSWIFPDDPIATPSTASDLLKCYPAAPHEV
IIRKPSQVGVARIGHEGALRKGRDALWAEFSDWLMGAPSTATAFHRHSNQ
QDQT
9rhob-a3ujv5: Oceanicaulis sp. HTCC2633 Alpha/beta hydrolase-like, 1 reference(s)Oceanicaulis sp. HTCC2633 Show
MARDAASMTSQRPVRLRTADGKLLSGVFLVPQAPNAVMVINPATGYRKDF
YLPFAEAAAENGWAVLIYDYRGQGESARCHPRRETARMLDWARYDIPAAA
EAACQAFPGLPLDIVGHSIGGQFAALIDPSLPVRRLALLSASSGYWGEQS
APLKYFAWAFWRVFGPAYLLLRGHIPKGVFWRGEPLPPRVWADWRDFGVN
PECFRDAIAELGLTSRYEGFTAPVRAWTPDDDPIANPQSVRWLLERYENA
QTEMKLVSHEDAGRGALGHDGLFRSKMADVFWPQVFRWLSQDAHRLARSG
9rhob-a3xb09: Roseobacter sp. MED193 Putative uncharacterized proteinRoseobacter sp. MED193 Show
MIQPTRREPISFVASDGVTLQGDLTRCNTPNLAVLISAGTGFPRQFYHAI
AQYMAERGAIVLTYDYRGIAGSCHGDLAQSEIEYADWGRYDMVAAVEHLS
QAAPGLRITHLAHSVGGHFIGVMSNHEAIDRHAFISVGTGFIGGHQLKNW
PLELYFWWGLGSYSLLRWGYIKPIGGWQGEALPPRVFKTWRKWSQRRRYF
QVDYEGLLKPQHYADVTAPIRSWVFSDDPIATPRAAQDLLDCYPNAAKSL
QIRTPTDIGVRRIGHEGAFRPGREPLWAECWDWLSQDRETP
9rhob-a4emj0: Roseobacter sp. CCS2 Putative uncharacterized proteinRoseobacter sp. CCS2 Show
MNMHVEIECKEQWFYSGGRRLSARVFLTAEPPRAVAVLNGATGVPQRYYA
DFARWLAKTQNIVCMTFDYRDFGTSARRSMKASDATMVDWGLHDQQAARD
HLAEMFPQTPLWVIGHSLGGLLMQFQKDLDRIDRVITVASGPVHITDHPF
PYRFTAAAYWFLVGPPATAIAGYMPGKRLRLGTDIPAGVFWQWRRWCTSR
SFFAAEMGRTLPLPDGTGLKAPLKVVAIKDDVLVPPHAVWRLMDYHQGAT
RSQLVVDPAAYGLTEVGHIAPFAARNKAIWSDLIA
9rhob-a4erq4: Roseobacter sp. SK209-2-6 Alpha/beta hydrolaseRoseobacter sp. SK209-2-6 Show
MKDVQQEQDTQFQRKSVEIKTEDGWLLTGDLTAAADPTSAVLISAGTGFP
KFFYHALADFLAARGALVLTYDYRGIGKSAVPDLRNSGIDYPDWGHYDMP
AALDFLHDRATSLPIFHIAHSVGGHFVGLMKNQNLIRRHAFLSVGTGYFG
GHHLRNWPLELYFWWGLGQYSLMRWGYLRPGGGWQGEALPPKLFRTWRRW
SCKRSYFERDYGSFLDPQYYSDVTAPIRSWVFTDDPIATERSGWDLLQAY
PKADRSLVIREPSAFGVRRIGHEGAFRPGRQALWQECWDWLNQDGEAQSA
Q
9rhob-b5j6a4: Octadecabacter antarcticus 307 Putative uncharacterized proteinOctadecabacter antarcticus 307 Show
MKVTPVTFLSGEHMLQGHLTAPATKPDTIAVLNAATGVPARFYNAFARWL
AVEKNIVCLTYDYRDFGASARGPMRQSSATMTDWAVHDQEAARRYAASSF
PDIPLWVIGHSLGTLCLPFQQNLYSIDRVIAVASGLVHVRDHPWPYQALA
RLFWFGPFPLAASIFGYLPGKKLRVGTDLPKGVYWQWRRWCTRRDFFARD
FGNELPFPDWMALKCAIKFVAIADDVMIPPATVWRLMQCYPAASKTQLAL
QPQDYELDKIGHIGVFSERCSVTWNDIVA
9rhob-b6bbi7: Rhodobacterales bacterium Y4I Putative uncharacterized proteinRhodobacterales bacterium Y4I Show
MLDRHAEHTAGIREEELRFASGEAVLAGRLYRPGGAARAAVVLNGATGVP
QRFYRHFARWLAAEQQIACLTYDYTDFGDSARGHPRRSKVTMADWALGDQ
PAARAEMRRHYAGVPLWVIGHSLGAMLMPLQNDLEDVARMIVVAGGLVHH
HDHPWPYRALALAFWFGHVPLAVRALGYLPGRAVGFGADLPAGVYWQWRR
WCTTRGSYLPETGQSLPLPRWAESGIPVDLFALADDDVVPPPAVWRLGEV
FGGANQRRKVLAPGDLGLKAIGHLGAFARENAALWPRLLP
9rhob-b6rac5: Pseudovibrio sp. JE062 Hydrolase, alpha/beta fold familyPseudovibrio sp. JE062 Show
MAMKQLEDMMAESEQRVETVKIPSEGATLTGKAYWPKGDPKSSVIIHGAT
GVPQLFYARFARWVAEQGHLCLTYDYRDFGASKQTHPRNSSATMADWGLL
DQQAAFDALLKLADTPQKHVIGHSLGGFMLPFHSNLDKVDKVTTVACGQV
YWRDHHLPYFFMVILFWYLLGPIATRLKGYLPGKALGLGADVPAGVYWQW
RKWCTSPTFYSSDIGGVLPQMNPNPYKGPIKIIGFTDDETAPKASIDRME
PLYKDAQIIRQTLNPADFELKEVGHLKAFTKQNEALWPEILEVS
9rhob-b9nlx7: Rhodobacteraceae bacterium KLH11 Putative uncharacterized proteinRhodobacteraceae bacterium KLH11 Show
MLDAQQTGMTEDFRFAAGSALLSARLYHPMTNPERVVVLNSATGVPRDYY
QHFARWLAETRGMACLTYDYRDFGHSLTGSQQRSKATMTDWALIDIPAAR
AEMRRRFPKAELWSIGHSLGGMFGPVQPDIDQIDRMICVCSGLVTLADHP
WPYRALATLFWYGHVPLTVQALGYLPGKAVGFGADLPAGVYWQWRKWCTA
PQNYVPDIGDTLPLARWAETGKRVDLFAFADDQMVPPSAVWRLADLYGSG
AQRHLLSPKELGLPKVGHIGVFARRNAVIWPRLLA
9rhob-b9qva3: Labrenzia alexandrii DFL-11 Putative uncharacterized proteinLabrenzia alexandrii DFL-11 Show
MSTVQPQSLTFQAEDGWQLTGDLYVGRSPKVAILVSSGTGFPRRFYRHMA
AYLAEQGAVVLTYDYRGIGGSKTASIARSAIDLPDWGRLDMPATIDVLEA
KAPDLPITHLAHSVGGHFLGLMPNHDKIARNAFLAVSTGYIGHHAAHYRL
MEAYFWWGLGSYSLMRHGQLKPIGGWRGEALPPEVFKTWRRWSHRPTYFQ
KDFESTLAPQHYDQVRSPIRSWLFTDDPIATPKAHEVLLDAYPNAPKSLT
LTSPKDLNVKRIGHEGAFKPECAPLWADVFEWLANGTETRGTDF
9rhob-c9cwa3: Silicibacter sp. TrichCH4B Putative uncharacterized proteinSilicibacter sp. TrichCH4B Show
MSPTPETISFGPSSSPLVGQWYPAQGQMQAAMVLHGATGVPQRFYRHFAA
WAAERGIGTLTYDYRDFGDSLRGPIRNSPTSMADWAVADQDAAQRKLAEL
APTGPLWVLGHSLGGLGVAFHTYPVRVSRIITLGSGMTHHWDHPWSYLPK
VLAFWFLLGPLATAVTGYLPGRRLGLGADLPAGVYWQWRRWCTRRDFFAS
DIGRSLPQPDFDAPHPPLELCVATDDVVVPPVAVQRYAAHFAPSRTQLRM
FDPGTYGLKHLGHVSFLGAGLGAGNAAAWDDLLLQQTAQVDAAPLRQAR
9rhob-d0cue6: Silicibacter lacuscaerulensis ITI-1157 Putative uncharacterized proteinSilicibacter lacuscaerulensis ITI-1157 Show
MLDSQQTVKVEDFEFSAGKANLSARLYAPMARPEIAVVLNGATGVPRDYY
QHFARWLAADRGMACMTYDYRDFETSLKGRLKDSDATMADWALKDMPAAQ
AEMRRRYPNAKLWVIGHSVGGMLGPLQPGIERIDRMICVCSGLVTLSDHP
WPYKGLAALFWYGHVPPLVRLLGYLPGRMLGFGSDLPAGAYWQWRRWCTS
PRSYLPELGDSLPQADWGRSSAPVEIIALEDDQTVPPPAVWRLADLYGAA
ARRHLLVPADFGLREVGHIGAFARRNRAIWPRLVA
9rhob-e0mkv4: Ahrensia sp. R2A130 Alpha/beta fold family hydrolaseAhrensia sp. R2A130 Show
MTERIRDLTLVSAGGWPLGATLFQAPSPNSEKPAVLISSAAGAPRGYYTK
FAQALIYGGAPAVLTYDYRGMHGSKGDRSRWPELRMFQWGEHDFTAVAEF
LKDHVQGGPIVGLGHSYGGQAPGLSAAWSLFERYGTVATLNGYWRGTDQP
IRVWLQTQIAGRALAKFWGHVPDSFPGAGGMPGTIMKDWADWIARPDYFF
DLEDVPATRHFPNVKLPLASFRPADDPWATKRAVETFMARYTAADLTHHV
IEPGPSGPIGHLGFFRSVHRESHWPTVIRYLLENKRPD
9sphn-q1ncx0: Sphingomonas sp. SKA58 predicted alpha/beta hydrolaseSphingomonas sp. SKA58 Show
MTPVEERIEILCKDDTRIAGHLWTAGGRQEGGSVIINPATGVVARYYHRY
ARFLASHGFDVITYDYRGIGLSRPQRLQDCGYRWRDWGELDFDAVLRFTR
ARRPESPLKVVGHSIGGFIPGLAESGDQIERMLTVGAQYAWWGDYAPRQR
AGLLLKWHLVMPVLTALLGYFPGKRLGWLEDLPAGVANEWSFRGARFERS
HPRGDREAVLERMAAVRGRILAVAVSDDPLGTVPAICRTLSYYRNAERTA
VLLSPHDLGRATIGHFDLFRAYHESGFWKDTLDWLKDRKLPWPNNVLATC
9vibr-e8ma37: Vibrio sinaloensis DSM 21326 Alpha/beta hydrolase superfamily proteinVibrio sinaloensis DSM 21326 Show
MQKMKQDQWIETGDGLTISASLFIPQSEPKGGVIINSATAVRQDYYAKFA
EFLRGNGYLVVTYDYRGIGRSSIKNSRDKRLTMSAWGEKDLSAVIHWASR
HAPQLDWHCVGHSVGGQIIGFADNNHSLKSVYCVSSQSGYWNHWESLSKL
RMLAMWYAVVPGLARCLGKVPGIFLGGESLPEGVARQWAYWGRDVNYIVD
EGGTPIRTGFARMECNMKFLLIDDDLDFAPPKAVAALRSFYANANSQLEV
VKAAQVGSKIGHFGFFRSKHEASLWPKALEWIDAHAG
acibt-a3m627: Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755; AYE; ACICU; AB307-0294; RUH2624; ATCC19606; 1656-2) Alpha/beta hydrolase, 4 reference(s)Acinetobacter baumannii Show
MDKTFESFWITCKDGYQLAAQFYPAQEKKAEYPILICPATGITKNFYHSF
ATWLSQQGYDVLSFDFRGIGESLHGALKQSTASITDWGTLDIPAAIDALL
IKTKANQVILIGHSAGGQLLGVVPNYNKVAKVITVAGSTGHIKGLKGKTK
VLAPVMFNLIFPISSLVKGYGATQFIGMGENLPKKVAQQWREFCSRPGYV
KNAIGKTIFHDFHLDIQCPITAIWADDDEIATKRNVQELLSLYPNANKKM
IELSPKDLGYKSIGHMLLFKKSHQKLWSILEQEIKH
acica-d0ryn5: Acinetobacter calcoaceticus RUH2202 Alpha/beta hydrolaseAcinetobacter calcoaceticus RUH2202 Show
MDNTFESFWMTCKDGYQLAAQFYPAESKKSANPVLICPATGITKNFYHSF
ATWLSQQGYEVLSFDFRGIGDSLHGPLKQSNASINDWGTLDIPCAIEALL
EKTQAEQVTLLGHSAGGQLLGIVPNFRKVAKVVAIAGSTGNVKGLKGKTK
FLAPVMFKVIFPISSTLKGYGATQFIGMGENLPKKVAQQWREFCSNPGYV
KNAIGKTVFQDFHTEIICPITSIWASDDEIATQHNVEELLSLYPNASTKM
LELNPLKLGYKSIGHMLMFKKSHQKIWPLLEQEIQY
acica-d0s0f8: Acinetobacter calcoaceticus RUH2202 Putative uncharacterized proteinAcinetobacter calcoaceticus RUH2202 Show
MKLVTQTNEQLSQNVQFPALDGYQLYGTRYFTTTAAKANIVVAGATGVPH
EFYRRFAEYMTQYSYQVFTFDYRGVGKSSPKSLKGFDMSYLDWGQYDLAG
AIEYLSQEPLPLLMVGHSYGGHALGLLPNHEKLLACYTFGTGAGWHGYMP
LKERFKVQVVWNIVFPPIVAVTGYLPWSKFNMGSDLPLNVYKQWRKWCKN
PKYFFADPEQQHLIEQYASVKTPIYAVSALDDDWALPASCRAFMQHYRQA
PVSYISLHPQDVSMKTIGHMGYFKKGAEHIWSKIRTTFDDLVQA
acide-c5t1g5: Acidovorax delafieldii 2AN Putative hydrolaseAcidovorax delafieldii 2AN Show
MNKQTLRVDEGASVALCVFEPTGAPRASVVVGGAMGVRQDYYAAFAQWLA
QQGFRVTTFDYRGHGDSLVGPMREVRANLFDWARDYEAVISAARAALPGQ
PLYLLGHSLGAQLPGLLRNPGQVDGLLSVAAGSGYWRDNAPRLRRMVPYF
WWVLVPLATRLCGYFPGRKLRKVGDLPAGVILQWRRWCLSPTYSVGAEGP
EVAQSYDAVRFPVLALSMSDDELMTLRGTHNLVNLYSNAPTRVERIVPQD
VKALRIGHFGFFREQFRQSLWPRAVGALQGLGGAGAVAGTTP
acig3-d6jt89: Acinetobacter sp. SH024 Putative uncharacterized proteinAcinetobacter sp. SH024 Show
MDNTFESFWMTCKDDYQLAAHFYPAQSPKSANPVLICPATGITKNFYHSF
ATWLSEQGYDVLSFDFRGIGGSLHGSLKQSTASINDWGVLDIPCAIDTLL
EKTKAEQVTLLGHSAGGQLLGIVPNFHKVAKVIAVAGSTGHVKGLKGKTK
FLAPVMFNVIFPISSAFKGYGATQFIGMGENLPKKVAQQWREFCSHPGYV
KNAIGKTVHHDFHSEIICPITSIWASDDEIATERNVEDLLKLYPNAPTKM
LELNPMKLGHKSIGHMLMFKKSHQNLWSLLEQEIQH
acijo-d0sat9: Acinetobacter johnsonii SH046 Putative uncharacterized proteinAcinetobacter johnsonii SH046 Show
MQATAHLDSIQIEKQTVKFSATDGYVLVGTRYRSSEPIKANIIVASATGV
PQQFYRHFAEYAVALGYQVLTFDYRGVGLSAPKQLKGFSMSYLDWGQLDL
SAAIDSICKDGKPIFVVGHSYGGQALGLTHNHDQVTAMYCFGTGAGWHGY
MPFREKMKVHVMWNIIFPPMVALKGYLPWSLLKMGTDLPVDVYTQWRKWC
KNPTYFFADPEQQHLLEQYAQVKTPIYAVSALDDDWALPNSRHAFMQHYR
HANMHYLNIEANDYGLKEIGHMGYFRQGAEVIWDNMLNTFDSYLSSQTTT
ER
acijo-d0scm9: Acinetobacter johnsonii SH046 Alpha/beta hydrolaseAcinetobacter johnsonii SH046 Show
MLKPIMQNYETLTITCSDHYSLSGRFYTAQGTQQALPVLICPATGITQQF
YHHFASWLAEQGYAVLVFDFRGIGESLHEPLKKSKASIVQWGQLDIPAAM
EVLLNKTQATQVILLGHSAGGQLLGINPNY