Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: abh_upf00227

abh_upf00227


Genes:Proteins in abh_upf00227 (848)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9alte-g6ypj5: Marinobacter manganoxydans MnI7-9. Putative uncharacterized protein, 1 reference(s)Marinobacter manganoxydans MnI7-9 Show
MKDMPKIYYLHGFASRFDINSDKLKTLARVGPVYGHDIDYTQGSEDVIEE
SLDKLMQVNPDLLVGTSMGGWLAGILGAEAGIPFVAINPVTEPAHALKSW
IGPGVDHQGQAYQLTDEVVSSYYPFTHYGSGLVLLDQGDELLPWNDTVRE
LGGYFSVHSFEGGSHRFEHMEEALELVREHVKD
9alte-h3zg93: Alishewanella jeotgali KCTC 22429. Uncharacterized protein, 1 reference(s)Alishewanella jeotgali KCTC 22429 Show
MSGNLPQQVQSVGSLRGFSVQQLYYLHGFASSSQSEKARLTQDYFAALPG
VQLTALDLPYTPAEAMATLQQQITAPPAAIIGSSLGGFLATVLAEQYGCR
ACLINPAVAPHKVLADYIGEYQHPVLQQRYQVRTEHMSQLASLMPLTLKR
PEQYFVLLQSGDEVLDYRQALKYYQGARFELVEGGDHSFVGYQQYLAQIA
EFCLQQP
9alte-h5teh4: Glaciecola punicea DSM 14233 = ACAM 611. Esterase yqiA, 1 reference(s)Glaciecola punicea DSM 14233 = ACAM 611 Show
MASISQTKPYMHHLVYLHGFLSSPHSLKAQQTISFANKHFPNLNVHVPEL
PGDINKAIELIDNLLATLALSHTGFIGSSMGGFLATYCVEKYALGNSPKA
VLVNPAVEPFKLLGNYLGQHVNPYTNKAFAIVPQHIVKLKQLYVNELAAP
ARYKVLLQTHDETLDYTLAAKKYAASDLVIEQGGNHSFVGYEVHLPSVFK
FLFA
9alte-i8u2j8: Alishewanella agri Alishewanella aestuarii. Uncharacterized protein, 2 reference(s)Alishewanella agri BL06 Show
MLYYLHGFASSSQSEKARLTVDYFSTLPGVQITALDLPYTPDAAMAVLAQ
QITAPPTAIIGSSLGGFLATVLAEHYGCRACLINPAVAPHKVLADYIGDY
HHPVLQQRYQVRTEHMTQLASLMPLTLKRPEQYFVLLQSGDEVLDYRQAL
EYYQGARFELVEGGDHSFVGYQQNLAKIAEFCLQQP
9alte-k7a3c8: Glaciecola pallidula DSM 14239 = ACAM 615. Esterase yqiAGlaciecola pallidula DSM 14239 = ACAM 615 Show
MDHIIYLHGFLSSPKSEKAQLVSKYVTHNHPNIKLHIPRLPGCPAKAVEI
IERLICTIFNNESLNQDTPINELRFIGSSMGGFLSTYCVETYGGKAVLVN
PAVEPFNLLTEYFGEHLNPHTGEVFSIDQNSVSQLLQLHKVIKKNTPNYL
VYLQKEDETLDYRLAEIKYGTDCCIIEAGGNHSFVGLENHLSEIIGFLSQ
9alte-n6wng0: Marinobacter nanhaiticus D15-8W. Esterase, 1 reference(s)Marinobacter nanhaiticus D15-8W Show
MSSEDLPRLIYLHGFKSSPQSQKVTELREWLEREALPIELVVPELGFAPD
EAIARVSRNIETAAGRPCGLMGSSLGGYYASALGARYNLRSVLINPAVAP
YRLLRRYIGVQENLYTGERFEVEEAHMDQLQAMDPSELARPERFLVCLQT
GDETLDYREAVHRYRHSPKWIQPGGDHRFQGFPRILPAALAFLKLLPGRR
Y
9alte-u7p295: Marinobacter sp. C1S70. Uncharacterized protein, 1 reference(s)Marinobacter sp. C1S70 Show
MLKTYYLHGFASRFDTTSEKLKTLAKLGPVYGHDIDYTQGSEDVIEESLD
KLMQVNPDLLVGTSMGGWLAGILGAESGIPFVAINPVTDPAHMLKPWIGQ
GLDHQGQAYQLADEVVSSYYPFTHYGSGLVLLDKGDELLPWNDTVRVLGD
YFPVHSFEGGSHRFEHMEQALRLIREHVKD
9alte-w7qh33: Catenovulum agarivorans DS-2. Uncharacterized protein, 1 reference(s)Catenovulum agarivorans DS-2 Show
MKKIVYLHGFLSSPKSVKAQQTVAYCQQYYPDSIEIVAPQLANTPEQVAI
QLAKILREQDIIGFIGSSLGGYLASYCAAKTALPAVLINPAAYPYQLLSD
YLGEHQHPYTNEKFVIDEQFNAALRQFDVTTQELQALKISVWLQTEDETL
NYKEAEEKYKHNELNIQAGGSHAFDNYLECLPTMLQYLFNHQFVK
9aqui-a8uui2: Hydrogenivirga sp. 128-5-R1-1. Uncharacterized proteinHydrogenivirga sp. 128-5-R1-1 Show
MFFYDDNNSEKLWIHLHGFASNVLGSKIEFARGLFKRTKSFSFYAMDMNY
EKHTTTEVLDVLEALVLGFSDRYRHITLCGSSHGAYIAANYVRFRKLGNV
KSLLLLAPSFETLALIVKELGEEKVRKWLEGEESLRFMEGELEIEVREDF
ATDIVKNGYEIIRGSEVDFPEEPPVDIVIVHGRRDEIVPIERTRLFVERV
RVKEFIEVDDDHQLSESFGRVLKQLLSEGKL
9aqui-a8v143: Hydrogenivirga sp. 128-5-R1-1. Uncharacterized proteinHydrogenivirga sp. 128-5-R1-1 Show
MKILYVHGFNSAGYGEKINHLKKAFGDENVISPTLSYDPEKAMKQLEFLT
EAVKDKDNLIIVGTSLGGFYAVYLSYKYNVPAVLINPSIDPYTSLSSQVG
HQKNYKSDEEYEFTKQHLESLKKYYVPEEKLKEIKDLIFVYLDEEDELLD
SKETRDYYEKHGVYVKMYPGGNHRFTHMPELIDDLKQKTNGGI
9aqui-c4fhl3: Sulfurihydrogenibium yellowstonense SS-5. Uncharacterized proteinSulfurihydrogenibium yellowstonense SS-5 Show
MKILYIHGFNSAGYGDKINHLKEAFGPENIIAPTLPYQPDKAMKLLEFLT
DSIKDKDKLYIFGTSLGGFYALYLADKFKIKAVLINPSIDPYKSLQKQVG
PQKNFKTGEEYYFSQENLESLKNFYVKDLSSLKNLVYVYLDEEDELLDSK
ETAKYFDGFHVVMYPGGNHRFTHMKELIEDFKKMEAL
9bace-e5ut73: Bacteroides sp.; Bacteroides massiliensis; Parabacteroides sp.; Bacteroides ovatus, PKD proteinBacteroides sp. 3_1_40A Show
MKKILFLHGFFATGSCPMAVALKEAFENHASVLTPDLPLHPKEALKQVRS
IIEQESPDLLLGNSCGSFLAQMLAPIVGIPALLGNPHFEMTKFLKERIGE
HQYKAPRKDGNQTFIIDEALIEEFAKLEKIQFDCCNPYYRDRVWGLFGEQ
DRLAHYEPMFLEHYNNSHHFPGAHTPTEQEVKTWYAPLAMKMLMEFPKKE
ERYFRHFKGGTYKYIHSAFDSETQERMVVYQALYGEKSYWVRPEKMFFET
IERDGRRFSRFTEIDI
9bace-e5x265: Bacteroides eggerthii; Bacteroides clarus Uncharacterized proteinBacteroides eggerthii 1_2_48FAA Show
MAQKILFLHGFFASGTCIPAFALKEYFSGKATVLSPDLPLHPQEAIDFIQ
RLCNQEQPDILVGNSNGSFLAQIVASKNNIPALLGNPHFEMTRFLMERIG
SHEYKSPRANGNQQLIINQALIDEFTELQQHQWDNSQVANQENIWGIFGE
NDHLAHYEPLFLMHYKYSYHFPGGHTPTVEEVQKYYVPLAERLLEL
9bace-f3zpr3: Bacteroides coprosuis DSM 18011. Uncharacterized protein, 1 reference(s)Bacteroides coprosuis DSM 18011 Show
MENKIIYVHGLSSSGATASAQNIQALLPQYQVVAPDMPLPPQQALQLLTD
LVAELQPVLVVGTSMGAMFTQQLHGQTKILINPAFHVSQLMRKNLGTQPF
FNPRKDGVMTFDITPQLCDAYEIMEKHQFDKVTVYDQEHTYGFFGTHDEM
VNCQEEFSRYYPHKVLFEGEHRLNPEVIERDLVPLIQSILMNS
9bace-r0iw74: Bacteroides salyersiae; Bacteroides sp. Uncharacterized proteinBacteroides salyersiae WAL 10018 = DSM 18765 = JCM 12988 Show
MKILYIHGLSSSGNSGTAEHLRRLLPNDTIFSPDLPIEPMVALEMLKRLV
KEEKINLVIGTSMGGMFAQKLQGTYKILVNPSLHVSRSMRCKLGINRFFS
ERQDGISEYEITPELCDRYEELEQTQCMAYSGEERDNTIALFGIGDDTVN
CREEYCEHYIKYFSFPGGHRLTEDVIRKYVLPIIEQ
9bace-r5mfp3: Bacteroides sp. CAG:1076. Uncharacterized proteinBacteroides sp. CAG:1076 Show
MKRKVIFLHGFFASGACTPAQALQESLSNKAQVLTPDLPLHPREALSFLR
QLCQQEAPDVLVGNSNGSFLAQIIASENGLPALLGNPYFEMTKFLTERIG
PHEYKSPRADGNQHFVIDQPLIDEFAEVQLHQWDHYQSANREHIWGIFGE
NDHLAHYEPLFLKYYPHSWHFPGGHTPTADEVHQYYVPLIEKLLTI
9bace-r5s895: Bacteroides sp. CAG:661. Uncharacterized proteinBacteroides sp. CAG:661 Show
MKPTILFLHGFFASGVCVPAQTLKQCFQDQATVLTPDLPLHPAEALASIF
RWCEQEKPDVLVGNSNGSFLAQIVAARNNLPALLGNPHFEMTRFLAERIG
THEYKSPRADGNQRLVIDQALIEEFADLQLHQWDNDRPDNHERIWGLFGE
NDHLAHYEPLFLKHYTHAFHFPGGHTPTEEEVRTYYAPLVAQLLEKRSGD
GRL
9bace-r5sep8: Bacteroides sp. CAG:545. Uncharacterized proteinBacteroides sp. CAG:545 Show
MELYEYARPDIMSGKKILYLHGFASSGQNGTVKTMGTLLPSAEIIAPDIP
VEPVEAMDMLKKLSESENPDLIIGASMGAMYAEMLRGYDRILVNPAFKLA
DTILKNNGLGRQEFHNPRRDGQTSFLVNKGLIEAFREVSSHNFEGLEPDS
SDPVFFGKVNEEKQRVYGMFGIHDTLVTGTFELFTTYYPNAIRFNGEHYL
DDSVFLHSVMPVIERIDDMQENRAKKVMLIALTDTLLDMTNGQAHGLAIE
DMEPYGSAVKAFAKLSEQYSPYVLISNDFNAPERLPELYHWVEKRLGVPA
WNRVVIANKKDMLLGDYLIDRYPERLGTDDFMGTVLHFGEEPFKTWEEVL
TYFSRLGGQ
9bace-r6e8f5: Bacteroides sp. CAG:709. Uncharacterized proteinBacteroides sp. CAG:709 Show
MNNYTILYVHGMGGGEDSRIPSILNQHINEFVNPEDTHIDVIVRTYDIDP
QIAMEQVTAWFNELEPQLVIGESLGSLHAIRLGGVPHIFVSPAVGAARWM
SIASYIPGAAAFMRNVFKPRPGSRQSLDFTREILSHYRGMRERVLSCSPS
HGSKDYFFAFFGTDDTYRRWGVVNIRSWARHFGKDSCQIYKGTHYMEEEY
LYSMLIPKVLNVLGVNRQMRCRP
9bace-r6nqw1: Bacteroides sp. CAG:443. Uncharacterized proteinBacteroides sp. CAG:443 Show
VMYIHGLSSSGASSTAINLRKLLPKYDVLSPDLPIQPQESLTMLKELCEL
YNPELIIGSSMGGMFAQQLRGYKKILVNPAFHVSKFMRTQLGVHDFLNPR
KNGETQYEITSKLCDNYQAIEANQFADITDFDIKNTYALFGTQDTLVHGY
DEYIGYYRNAMWFEGEHRLNFEILKKIVVPLAKIILWR
9bace-r6u543: Bacteroides sp. CAG:770. Uncharacterized proteinBacteroides sp. CAG:770 Show
MELYEYARPDIMAGKTILYLHGFASSGQNGTVRAMTTLLPETRIIAPDIP
VEPQEALTFLNDLCAKENPDLIIGASMGGMYAELLRGFDRILFNPAFFLA
DTLQKNNGLGRQEFHNPRRDGQTSFLVTKGLLESFREVSSHCFENMTDNA
ADPSSFGEMTDERDHVYGMFGTQDNFVTGTFDVFRKYYANAIHFEGEHYM
DDSVLLHSVLPVIERIDDKQEKRSKPVMFIALTDVLLDLRNGVSRGKSID
EMEPYGSAVKAFAALTRNYSPYVLITNDFNEPERIPALTRWVEKCIGVPA
WNRVVICNRKDMLLGDYLIDRYPERLNSDDFMGTVLHFGEEPFKTWEEVL
TYFSRLGGQ
9bace-r6yxr7: Bacteroides sp. CAG:714. Uncharacterized proteinBacteroides sp. CAG:714 Show
MTKKILFLHGFFASGACIPACTLKQCFEGKAEVLTPDLPLHPLEALAFIR
HLCEQERPDVLVGNSNGSFLAQIVASASGIPALLGNPHFEMTWFLSERIG
THTYKSPRTDGKQQFTITPTLIDEFAGLQLHQWNACSPANQDRVWGLFGE
NDHLAHYEPLFREHYSHVFHFPGAHTSTAEEVQKYYVPLVKKLMELSCNE
S
9bace-r6zyf2: Bacteroides sp. CAG:875. Uncharacterized proteinBacteroides sp. CAG:875 Show
VMYIHGLSSSGASSTAINLRKLLPKYDVLSPDLPIQPQESLTMLKELCEL
YNPELIIGSSMGGMFAQQLRGYKKILVNPAFHVSKFMRTQLGVHDFLNPR
KNGETKYEITLDLCDSYQLIEANQFADITDFDIKNTYALFGTQDTLVHGY
DEYIDYYRNAMWFEGEHRLNFEVIKNIVVPLVKIILRL
9bace-r7auy2: Bacteroides sp. CAG:875. Uncharacterized proteinBacteroides sp. CAG:875 Show
MEARKLIFLHGFFASGACIPAQALKECMAGKALVLTPALPLHPQEALAFI
RRLCEQEQPDLLVGNSNGAFLAQIVASENGLPALLGNPYFEMTRFLTERL
GPHAYKSPRADGRAHFVIDQALIDEFAEVQRHQWDHCTPEGRERIWGLFG
ENDHLAHYEPLFLTHYTHAFHFPGQHTPTAEEVRMYYVPLIEELWKAQSP
SNL
9bace-r7cwb5: Bacteroides sp. CAG:462. Uncharacterized proteinBacteroides sp. CAG:462 Show
MRTTKILFLHGFFASGSCIPAQALKQAFEGKVEVLTPDLPLHPREALTFI
TNLCEHEHPKVLVGNSNGSFLGQIVASRLGIPALLGNPHFEMTCFLSERI
GAHEYKSPRADGQQHFVIDQPLIDEFADIQAHQWDDCRPEMTNRIWGLFG
RNDHLAHFEPLFLQHYTHAYHFPGTHTPTAEEVREYYVPLVERLIE
9bace-u2cw34: Bacteroides pyogenes F0041. Uncharacterized proteinBacteroides pyogenes F0041 Show
MKKILFLHGFTSSGSCDMALALREALVEEARVIAPDLPLYPEEAIALIER
EIRIHRPQLVVGSSCGGFYARMFVSAHRKVILINPYFAMTEFLQTRIGTH
RYKSSRADHRQEFKVTQRLVKHFRMMGTVQFADYTPRHKRYVYGLFGTQD
TLAHFRPVYDRFYVHAKEFDGGHTMTSENVKEVLAPLAGKVLRLPKTGE
9bace-w4pec1: Bacteroides pyogenes. Uncharacterized protein, 1 reference(s)Bacteroides pyogenes JCM 6294 Show
MKKILFLHGFFATGSCPMARVLREAFDGQAIVLTPDLPLHPKEALKYIRM
LIDKEKPDLLIGNSCGAFLAQMLSPVVGIPALLGNPHFKMTDFLRERIGE
HEYKAPRMDGNQTIVINESLINEFEQLEALQFDYCNPYYKDRVWGLFGEQ
DTLAHFEPLFLQHYNNSYHFPGGHTPTEQEVRTWYAPLVQKMLMEYSVKE
ERFFRHFKGGMYKYIHSAYDSETQERMVVYQALYGEEAYWVRPEKMFFEK
ITRDGRTFNRFTEIDR
9bact-a1zj37: Microscilla marina ATCC 23134. Uncharacterized proteinMicroscilla marina ATCC 23134 Show
MNLLYIHGLDSSPRPDKVAVLQSIADNVWAPQLNYRENPHTFTYLLDGAK
KREINYIVGSSAGGFMGYWLAPHLQCKALLFNPALAFQSIIQQIVTPTTV
ASFQPFYSIILGGQDDVIPPQTTLDFLVEHNSPAQYQLDQIDSLGHQIDM
QTYEYACYKYIVK
9bact-c9pui7: Prevotella sp. oral taxon 472 str. F0295. Uncharacterized proteinPrevotella sp. oral taxon 472 str. F0295 Show
MKGKKIMYVHGFGSSGQSGTVTLLRTLMPESTVVAPDLPLHPAEALALLR
QTCDIEKPDLIIGTSMGGMYAEMLRGTDRILINPAFEMGDTMVKHNMVGK
QTFQNPRVDGVQDFIVTKALVNEYKEITTQLFNGIDETERQRVTGLFGDE
DTSVDTFDIFAQHYPTAIRFHGGHRLTDKVALHYLVPLIRQIDDRQTGRQ
RPIVFIDANTLADSYQKPMPSMHKAYEMLIENYDVYILAPSPTNAPEHIT
AQMAWVEQHLNAPAFNRVVLCNNSNLLYGDYLISRHEHPNFLGSAILFGG
NDLKTWDDIIVFFDRLGGQ
9bact-d1p9d7: Prevotella copri; Prevotella stercorea; Prevotella sp. human gut metagenome; Uncharacterized protein, 1 reference(s)Prevotella copri DSM 18205 Show
MKKILFLHGFFATGSCPMARALKEAFEGTAVVLTPDLPLHPKEALKEIRS
IIDREQPDLLLGNSCGSFLAQMLAPVVGIPALLGNPYFMMTEFLKERIGE
HEYKAPRRDGNLRLVIDEALIEEFAELEAVQFDHCNPYYKDRVWGLFGEQ
DTLAHFSPLFLKHYNQAFHFPGGHTPTEQEVKTWYAPLAQKMLMEFSAKE
ERYFQHFKGGKYKFIHSAFDSETQERMVVYQALYGDQAYWVRPENMFFGK
VTRDGRTFNRFTEIDIK
9bact-d1pcp9: Prevotella copri. Uncharacterized proteinPrevotella copri DSM 18205 Show
MNPYIKQFPDLMAGKKIMYVHGFLSSAQSGTVKMLQELMPNATLVAEDIP
VHPEEGIEMLQKMAETEKPDLIIGTSMGGMYTELLKGFDRILVNPAFKMG
DTMSSMTGKQEFQNPRKDGVNELMVTKGLIKEYRDFTERCFQDITPEEQQ
RVYGLFGDADPLVHTFDLFHEHYPLAIPFHGEHRLIDKVAFHYLCPVIRW
IDDKQNGKERPIVYIDFDALHDSYMKATSSMHKAYEMLIEHYNVYIVAPA
PTNDHEYMAKVQTWVEEYLSTPAYNHIIFCNQKNLLYGDYFIDPSPCDGF
MGTTIEYGSDEFKTFEEIITFFERLGGQ
9bact-d1pu34: Prevotella bergensis DSM 17361. Uncharacterized proteinPrevotella bergensis DSM 17361 Show
MDNPYIKQFPDLMNGKTIMYNHGFGSSAATGTVARIRQVFPHARVVAFDI
PLHPEEALDFLKKKAAEERPDLIIGTSMGGMYTEMLYGYDRILVNPAFQM
GQTMKDHGMTGMQTWQNPREDGEKEFIVTKALEKEYKEMTERCFVELEAM
TPEQKTEEQRRVWGLFGDADPVVHTFDLYRSHYPQAAHFHGEHRMDDRSF
MNGVVPAIRWIDDKQEGRERHIVYIDQSTLCDGWGKPASSLVKAFSMLVE
TYDVYIVMPAPTNEHETFAANAAWVEQYLSTPAHDRVIYTNRKHLLYGDY
FIDTNPCEEFMGTGIAFGSDEFKTWEEIITFYKRLNGQ
9bact-d1vza8: Prevotella timonensis CRIS 5C-B1. Uncharacterized proteinPrevotella timonensis CRIS 5C-B1 Show
MDTVRQKQYPDLMVGKTIMYVHGFMSSAQSGTVSILKELLPKANIIAEDL
PIHPTEAIELLKKLCQEHQPDLIIGSSMGGMYTEMLKGYDRIVVNPAFQM
GETMHDHNMMGKQTFLNPRKDGVQEVIVTKSLVNEYKEITQQCFQAITDE
ERKRVYGLFGDKDPLVHTFDLFYEHYPNAIHFHGAHQLTNKVAFHYLIPV
IRWIDDKQEKRERPIIYIDYETLHDSFGKATSSMHKAYEMLIEKYQVLIT
APAPTNEHTSLTDVQTWVEEYLSTPAYNKVIFTNQKHLLLGDYLITPTLE
KDFMGTCLVYGSDEFKTWEELITYFNRLGGQ
9bact-d1w6g6: Prevotella buccalis ATCC 35310. Uncharacterized proteinPrevotella buccalis ATCC 35310 Show
MENPTKKQYPDLMKGKTLMYVHGFMSSGQSGTVAMLRELLPQANVVAEDL
PVHPAEAIDLLKQLCQSHKPDLIIGTSMGGMYTEMLTGYDRILVNPAFQM
GLTMHDHGLTGKQSFHNPRKDGETEVIVTKSLVNEYKYITEQCFANVTPE
EQRRVYGLFGDKDPLVHTFDLFREHYPQAIRFHGAHRVTDKVAFHYLIPV
IRWIDDQQEGRERPIVYIDYATLHDSYGKATSSMHKAYKMLIERYQVYIV
AAAPTNNHAYMGEVQAWVEEYLSAPAYNRVIFTNQSQLLYGDYLITPEAQ
DGFMGTCLAYGSDEFKTWEELIVYFDRLGGQ
9bact-d1y0u4: Prevotella bivia. Uncharacterized proteinPrevotella bivia Show
MSGKKILYVHGFLSAGSTHTAVILRTYMPNATVIAPDLPIHPADAMELLR
NLVKAEQPDLIIGTSMGGMYAEMLYGYDRILVNPAFQMGSTMGEQSMMGK
QTFQNPREDGIQEFIVTKSLVKEYRDTTELCFAQITPEEQAHVYGLFGDN
DPVVHTFDLFQEHYSQAIHFHGGHQLLEKVIYHYLIPVIRWIDDKQEDRE
RKTIFIDQSALADDYGKPKSSLHKAYEILLENYNVFFTVPAPTNSLEFIG
KAQAWIEDIFSAPAWNRVIYTNQMHLLYGDYLITSHKTDFLGTTIPFGSD
EFKTWEEVITFFERLGGQ
9bact-d3hxf1: Prevotella buccae; Prevotella sp. Uncharacterized proteinPrevotella buccae D17 Show
MENPYIKQFPDLMSGKTIMYVHGFGSSAASGTVKRIRETLPSARVVAYDL
PLHPEEAMALLQEKCAEERPALIIGTSMGGMYAEMLRGYDRILVNPAFEM
GDTMHEHGMMGKQVFQNPRQDGVQEFIVTKALVKEYRDITARCFAGITDD
ERRRVWGLFGEEDPVVHTFDLFRSHYPQAVHFHGEHRMTDKSFLHGVLPV
IRWVDDRQESRERPIVYLHWNTLADSYGNPKSSLNKAYDLLVERYEVYVV
VPAPTNDHASLTAAQEWIERYLSTPAHDRVVFANQKALLYGDYFIDSEPC
KDFMGTTLAFGSDDFKTWEEVIVFFERLGGQ
9bact-d3ib77: Prevotella sp. oral taxon 299 str. F0039. Uncharacterized proteinPrevotella sp. oral taxon 299 str. F0039 Show
MAGKKVLYVHGFMSSAQSGTVHLLKELMPQAEIIAEDLPLHPQEALDMLR
ELCKSEQPDLIIGTSMGGMFTEMLYGYDRIVVNPAFRMGETMSKHGHMGK
QVFQNPRKDGVQEFIVTKALVKEFDEVTAQCFTQVTNDEQQRVYGLFGDE
DEFVTCSDLFEQYYTNSISFHGGHRLTDKVALHSLLPVIRWIDNKQEQRE
PPVVYISYETLLDAYAKPKSSLMKAYEMLLVNYNVVIVVPSAPYHPEITA
EKQQWIEQYLSVPAYKHVVLCDDISLLYGDYLITTNEDAPFLGTVITFGS
DEFKSWEDIIVYFSRLGGQ
9bact-d3ik53: Prevotella sp. oral taxon 317 str. F0108. Uncharacterized proteinPrevotella sp. oral taxon 317 str. F0108 Show
MDPTKTYPALMKGKKIMYVHGFGSSGQSGTVTLLRTLMPAATVIAPDLPL
HPAEALELLKQTCDAEKPDLIIGTSMGGMYAEMLRGTDRILINPAFEMGD
TMVKHNMVGKQTFQSPRTDGIQDFIVTKALVNEYKEITTLLFNGIDEAEQ
QRVIGLFGDEDTSVDTFDLFAQHYPTAIHFHGGHRLTDKVAMHYLMPLIR
QIDDKQTGRQRPIVFIHANTLADSYQKPMPSMHKAYEMLIENYDVYILAP
SPTNAPEQITAQMAWVEQYLNAPAFNRVVFCNNANLLYGDYLISRHEHPN
FLGSSILFGGNDLKTWDDVIVFFDRLGGQ
9bact-d4m8c0: Fretibacterium fastidiosum. Uncharacterised protein family (UPF0227)Fretibacterium fastidiosum Show
MFINIHGFGGQGENTKYLWLRKTYPEEEIFCPTFDYTTAHPEEVLSRYEA
EVRAQVKAGRSVRVVGTSWGGFFAYCLNALFPSLPTVLVNPSLNPHLSRR
CIVLNHDLLLEYMEVLSRHMLRHSDASCAVIIGSRDEVIPHEVVTVPIFA
PESVHRFDVQHSFDMDAEPELPRLMMEHFGRTFA
9bact-d7nf24: Prevotella oris. Putative uncharacterized proteinPrevotella oris Show
MDNPYSKQFPSLMKGKKIMYVHGFLSSAQSGTVKMLQELMPKSSVIAEDI
PVHPEEAMQMLRKMADNEQPDLIIGTSMGGMYTEMLHGFDRILVNPAFAM
GDTMSSMTGHQEFQNPRKDGVQDLMVTKGLIKEYKDMTTQCFANIDTEER
ERVYGLFGDNDPVVHTFDLFRQHYPNAIYFHGEHRLIDKVALHYLIPVIQ
WIDDRQNGTERPIVYLHFDALHDSFGKPLSSMHKAYELLLEHYQVYIVAP
VPTNNHAYTEEVQHWTEEFFSAPAYNHVIFTNQKNLLYGDYFIDPKPHPD
FMGTTIAFGNDEFKTWEEVITFFERLGGQ
9bact-e0ntn1: Prevotella marshii DSM 16973. Uncharacterized proteinPrevotella marshii DSM 16973 Show
MEYRKTFPDVMAGKKILYVHGFCSSGQSGTVHLLRTLLPNTVVIAPDLPL
HPEEAMTLLRETCAIEKPDLVIGSSMGGMYAEMLYGFDRILVNPAFEMGD
TMTHHGMLGKQQFLNPRRDGVQEFIVTKALVKEYKEITEQCFAKVDEVER
QRVTGLFGDKDPLVDTFELFNSHYPNALHFHGAHQLLDRVAVHYLVPVIR
QIDDRQEKRERPVVYISPTALRDEAGKARPSMYKAYEALLEHYRVYLVAP
APTNHHAAIGEFQCWTEEALSTPAHDHIVFTNCRSLLYGDYLIDTTPCTE
FLGTVLLLGSDTFKTWDDLIVYFERLGGQ
9bact-e1gxi7: Prevotella amnii CRIS 21A-A. Uncharacterized proteinPrevotella amnii CRIS 21A-A Show
MSGKKIIYVHGFLSAGSTHTAVLLREYMPNATVIAPDLPVHPLEAMELLK
ELVKKEQPDIIIGTSMGGMYAEMLYGYDRILVNPAFQMGDTMSKNNMIGK
QTFANKRQDGVQEIIVTKSLVKEYRDMTQQCFGHVDEKEQSRVYGLFGDK
DPMVHTFELFENYYPQAIHFHGEHQLLEKVVYHYLIPIIRQIDDRQEGRE
RKTIFIDYTTLSDDYGKPKSSLHKAYEYLQEYYNIFFTVPAPTNNISFID
KQRAWIEDVFSAPAWNRVVFTNHIPLLYGDYLITTSKTDNFLGTTIAFGS
DDFKTWEDIILFFERMGGQ
9bact-e1kr29: Prevotella disiens, Uncharacterized proteinPrevotella disiens FB035-09AN Show
MENQYRKTFADLMVGKKIVYVHGFMSSGATHTAKILQEYMPESTVIAPDL
PIHPEEAMSLLRQIQADEQPDLFIGTSMGGMYTEMLYGTDRICVNPAFHM
GTTISESNMLGKQVFQNPRKDGVQEIIVTKALQKEYKEITEQCFSAITEE
EKSRVYGLFGDADPIVHTFDLFHEHYSQAIHFHGEHRLVEKAIFHFIMPV
IRWIDDKQEGRERKTVLIDWSTLSDNYGKPKSSLFKAYEMLLNHYNVYFV
APAPTNNPTAMIEVQKWIKEVFSAPAWNHVLFANEPQLLLGDYLISTNKN
DGFMGTTLQFGSDEFKTWEELIIYFERLGGQ
9bact-e7rm05: Prevotella oralis. Uncharacterized proteinPrevotella oralis ATCC 33269 Show
MENQYIKQYSDIMSGKTILYVHGFGSSAQSGTVKRIQDTLPQSKVVAYDL
PLHPEEAMSLLRRVCSEQNPGLIIGTSMGGMYTEMLYGYDRIIVNPAFRM
GETMHEHGMMGKQTYQNPRQDGIQEFIVTKALVKEYKEITEQCFAHVTAE
ERNRVYGLFGDQDQVVHTFDLFHEHYPNAIRFHGEHRLTDKSFFHSVMPV
IRWIDDRQEGRERPIVYIHDNTLRDAYGKPKSSLNKAYEFLIEKYDVYIV
VPAPTNNHPMIDAAQTWTENILGTPAYDRVIFCNQRRLLYGDYFIDAAPC
KEFMGTTITFGSDDFKTWEDVIVFFERLGGQ
9bact-f0f4h3: Prevotella multiformis; Prevotella denticola. Uncharacterized proteinPrevotella multiformis DSM 16608 Show
MENQYKKTFPDLMAGKKIIYVHGFMSAGSTHTAQILRDYMPQATVIAPDL
PIHPEEAMELLRNLVGTEKPDLIIGTSMGGMYTEMLYGIDRICVNPAFQM
GATLTESNMMGKQVYQNERQDGVQEVIVTKALVKEYRDMTEQCFSQVNEE
ERQHVFGLFGDADSVVHTFDLFREHYPQAIRFHGEHRLIEKAIFHYLMPV
VRWIDDRQEGCERRTVFIDQNTLADGYGKPKSSLHKAYEFLLDNYNVFFV
CPAPTNSPEAIARQQEWIEETFSTPAWNHVVFTNQPQLLYGDYLISSTGN
DDFLGTTLHFGSDEFKTWEEIITFFERLGGQ
9bact-f8ncf3: Prevotella multisaccharivorax DSM 17128. Uncharacterized proteinPrevotella multisaccharivorax DSM 17128 Show
MEKDNPYIKQYPDLMQGKKMMYNHGFGSAASSGTVKLIRQTFPNAEVVAY
DIPLHPAEGLALLKEKAEVEKPDLIIGTSMGGMYTEMLYGFDRICVNPAF
EMAQTMKEHGLTGKQTWQNPRQDGETEFMVTKALEKEYKEMTDQCFTAME
AMTAEEKAKELQHVWGLFGDEDDVVNTWDVFCSHYVQAAHFHGAHRMDDK
SFLAGVVPVIRWIDDRQEGRERQIVYIDSSCLADSYGKPRPSLHKAFSTL
VEKYQVYIVVPAPTNSHDSFAQNAEWIERYLSTPAHDHVIYTNQKQLLYG
DFFIDMRPADNLLATAIQLGSDEFKTWEEVITYFSRI
9bact-f9db52: Prevotella nigrescens; Prevotella intermedia. Uncharacterized proteinPrevotella nigrescens ATCC 33563 Show
MENQYRKTFPDLMVNKKLVYVHGFMSSGATHTAKILQEYMPQCTVIAPDL
PIHPEEAMELLRKIQADDRPDIIIGTSMGGMYTEMLYGTDRICVNPAFQM
GSTISESNMLGKQVYQNPRKDGVQEVIVTKALQKEYKEMTERCFSAVTPE
EQERVYGLFGDADPIVHTFDLFHQHYPQAIYFHGEHRLIEKAIFHYIMPV
IRWIDDKQEGRERKTVFIDWETLSDSYGKPKSSLHKAYEFLLDHYNVYFT
VPAPTNNPAALTEMQAWISDVFSAPAWNRTLFVNQPQFLLGDYLISTYSN
EDFMGTVLPFGSNEFKTWEEVITYFERLGGQ
9bact-f9deg9: Prevotella pallens ATCC 700821. Uncharacterized proteinPrevotella pallens ATCC 700821 Show
MENQYKKTFADLMVNKKLVYVHGFMSSGATHTAKILQEYMPQCTVIAPDL
PIHPEEAMELLRKIQADERPDIIIGTSMGGMYTEMLYGTDRICVNPAFQM
GSTISESNMLGKQIYQNPRKDGIQEVIVTKSLQKEYKEITEQCFASVTPE
EQERVYGLFGDADPIVHTFDLFHQHYPQAIYFHGEHRLIEKAIFHYVMPI
IRWIDDKQERRERKTVFIDWNTLSDDYGKPKSSLHKAYEFLLNNYNVYFI
APALTNKPTSFTEIQAWISDAFSAPAWNRTIFVNQPQFLLGDYLISTHIY
DEFMGTILPFGSDEFKTWEEVITFFERLGGQ
9bact-g1vgh9: Prevotella sp. C561. Uncharacterized proteinPrevotella sp. C561 Show
MENQYKKTFPDLMVGKKIIYVHGFMSAGSSHTVQILRDYMPEATVIAPDL
PIHPEEAMELLHNLVDTEKPDLIIGTSMGGMYTEMLYGVDRICVNPAFQM
GTTISETNMMGKQVFQNPRQDGIQEVIVTKALVKEYKEITEKCFSQVTEE
EQQLVFGLFGDADPVVHTFDLFNEHYPQAIRFHGEHRLIEKAIYHYLMPV
IRWIDDRQEGRERRTVLIDQNTLADGYGKPKSSLNKAYEFLLDNYNVFFA
CPAPTNNPSAITEQQAWIEDTFSAPAWNHAIFTNQPQLLYGDYLISSKKH
DDFLGTTLLFGSEEFKTWEEVITFFERLGGQ
9bact-g1we67: Prevotella oulorum F0390. Uncharacterized proteinPrevotella oulorum F0390 Show
MENPYIKQFPQLMAGKTVMYVHGFLSSAQSGTVKMLRELMPQATIIAEDL
PVDPEAAMQLLRELVAQHQPQLIIGTSMGGMYTEMLRGVDRIVVNPAFEM
GDTMSSMMGRQEFQNPRQDKVQELMVTKGLIKAYKDCTTHCFEGLDEADR
QRVYGLFGDEDPVVHTYDVFHAHYPNAIYFHGAHRLTDKIALHALIPVIR
WIDDQQNNTERPIVYLHYDALHDAYGKATSSMHKAYELLLENYQVYVVAP
APTDNHPYLNAVQTWVEDFLSTPAFNRLIFCNQPQLLYGDYFITPYAIPN
FMGTVVQWGSDEFKTWEEIITFFERLGGQ
9bact-g5gcr5: Alloprevotella rava F0323. Uncharacterized proteinAlloprevotella rava F0323 Show
MDFKQTFDYFAGKKILYVHGFGSSGATHTAALLQQKMPDAKVLHPDIPLM
PAEQLPFLKALCEAEQPDLIIGTSMGGMLVEKLRGFDRICVNPAMHMGQT
MGTSIKFGEYPIATPREDGVTKINVTKALAKEFDEVCALNFEGLDSEDAA
RVVGLFGTRDPFVNCFAEFSEHYPSSAYFEGEHRLTDEVLLHSVMPIVRR
FWEHQAALDSPAVFIDYATLRDDYGKQRSSARLAFETLSQRYNVYCVVPQ
DAQPQQWLQENIGVPAWNHLFLTNHRERLYGDYLITLDARDEDTFLGTTL
LFGSPQFKTWDALLEYFDQLGGQ
9bact-g6ajp5: Prevotella histicola F0411. Uncharacterized proteinPrevotella histicola F0411 Show
MENQYKKTFPNLMVGKKIIYVHGFMSAGSTHAAQILRDYMPQATVIAPDL
PIHPEEAMELLRNLVKTENPDLIIGTSMGGMYTEMLYGVDRICVNPAFQM
GSTITESNMMGKQVYQNERQDGEQEIIVTKALVKEYKEMTEQCFAQATEG
EQLKVFGLFGDEDPIVHTFDLFSEHYTQAIHFHGEHRLIEKAIFHYLMPV
IRWIDDRQEGRERRTVLISQDTLADGYGKPKSSLHKAYELLLDNYNVYFV
SPAPTNNPSVITEQQAWIEETFSAPAWNHAIFTNQPQLLYGDYFISSTEQ
PDFLGTVLRFGSDEFKTWEEIITYFERLGGQ
9bact-h1hmr3: Prevotella maculosa OT 289. Uncharacterized proteinPrevotella maculosa OT 289 Show
MENAYSKQFPTLMRGKKIMYVHGFLSSAQSGTVKMLQELIPGATIVAEDI
PLCPQDAMPLLRNMVDEERPDLIIGTSMGGMYTEMLRGTDRILVNPAFEM
GDTMSSMMGRQVFQNPRKDGVQEVIVTKGLVKEYRDITAQCFANIDAEER
KRVYGLFGDNDPVVHTFDLFKAHYPNAIRFHGEHRLIDKVAFHYLVPVIR
WIDDRQNGTERPIIYLHYDALHDHFSKPLSSMHKAYELLLEHYQVYVVAP
VPTNNHAYTDEVQRWVEEYLSAPAYDRVVFTNQKNLLYGDYFIDPQPDPN
FMGTTIAFGSDAFKTWEEVITFFERLGGQ
9bact-h8xw46: uncultured bacterium. Carboxylesteraseuncultured bacterium Show
MKILYIHGFNSAGYGEKINHLREAFKPRNVVSPTLHYDPEEAMSQLEFLT
ECMKEKDQLFIFGTSLGGFYALYLSYKYKVPSVLINPSIDPYQSLFSQVG
PQKNFKTDEDYVFTKEHLEKLKNYYIKDLDSVKDLAYVYLDEEDELLDSK
KTAEYFKGFHVVIYPGGNHRFTHMKELIEDFKKILEERWKR
9bact-i0tfw9: Prevotella sp. Prevotella veroralis, Uncharacterized proteinPrevotella sp. oral taxon 306 str. F0472 Show
MENQYKKTFPDLMVGKKIIYVHGFMSAGSTHTAQILRDYMPQATVIAPDL
PIHPEEAMTLLRNLVKAEQPDLIIGTSMGGMYTEMLYGTDRICVNPAFQM
GATITESNMMGKQVFQNVRQDGIQEVIVTKALVKEYKDMTENCFKQVDAK
EQERVFGLFGDADPIVHTFDLFSQHYPQAIYFHGEHRLIEKAIFHYLMPV
IRWIDDRQEGRERRTVLIDKDTLADAYGKPKSSLHKAYELLLDNYNVYFV
CPAPTNQPSAISEQQAWIEETFSAPAWNHAIFTNQPQLLYGDYLISSTAH
DDFLGTALRFGSDEFKTWEDVITYFERLGGQ
9bact-l1mkz2: Prevotella sp. oral taxon 473 str. F0040. Uncharacterized proteinPrevotella sp. oral taxon 473 str. F0040 Show
MKKILFLHGFASSGHSGTVMTLRQLLYADGVSVIAPDLPVMPQAAMTLIA
QIIEEEKPDVVVTSSMGGLFGEQLRGIPRVLINPAWSMSRLLTFGGMGRR
EFYNKRADGAKDFKVDKEMVAEFKAIEKSTGKGVTAEDKQLVWGLFGDKD
KRVNHQKDYVKYYGKEHFVVFDGEHSLNDKVLSRVVLPIVRQLLGLN
9bact-l1nkn2: Prevotella saccharolytica F0055. Uncharacterized proteinPrevotella saccharolytica F0055 Show
MDIIKNFPALMQGKKLMYIHGFGSSAASGTVTLLRTLLPSAEVIAEDIPL
HPAEGLEMLRTLCKTHQPDLIIGTSMGGMYTEMLRGYDRILINPALQMGD
TMIKHDMLGRQTFQNPRKDGVQEFIVTKSLVNEYKDVTAGVFAGLTPEDA
ARVIGLFGDEDDVVNTFDLFREQYPVAIRFHGGHRLTDKVALHYLIPVIR
WIDDRQNGRERSIVYLEMSALADAFNKPRPSMHKAYELLIENYDVYIVAP
APTNHPEKVTQVQLWVEQYLNVPAYNRIVFTNRPALLYGDYFISSSVPEG
FMGTSLLFGSSEFKTWEEVITYFDRLGGQ
9bact-r5cak0: Prevotella sp. CAG:1058. Uncharacterized proteinPrevotella sp. CAG:1058 Show
MEINYKIQFPGMMKGKTILYVHGFASSGQSGTVVKLREMLPGATVVAPDL
PLHPEEAMALLRDVCSKENPDLIIGTSMGGMYAEMLYGYDRILVNPAFEM
GETMYKHGHVGKNTYHSRRLDGVQDFILTKAMVEEYKAVTEQCFSGADGE
DAGVQVYGLFGDEDPIVHTRDMFAAHYRNAISFHGEHYMNDKVLLHSLIP
VVQWIDDRQDGRVRPIVYISIDALRDARGAQHSSAMKAYRFLLENYTVYV
VAPSPTNEPEYVAGVTAWVNDIVNVPAWNHVVFTNRKDLLYGDYLVDPSA
DLGAADFVGTRIVFGDDTFKTWEEIIEFFGRLGGQ
9bact-r5cph8: Prevotella sp. CAG:255. Uncharacterized proteinPrevotella sp. CAG:255 Show
MDKKILFLHGFFASGQCVPALSLREALKGKAEVITPDLPIHPDEAMAMIK
DICDSEKPDVLVGNSCGSFYAQMAANIEGIPALLGNPYFMMTEFLKTRIG
EHEYKSPRQNGRQRLVIDEKLISEFAEMEAVQFEYCKDENKERIWGLFGE
NDTLAHFEPLFMEHYKHAYHFPGGHTPTADEVKEWYVPLAEKMLVQNL
9bact-r5fci9: Prevotella sp. CAG:924. Uncharacterized proteinPrevotella sp. CAG:924 Show
MENPYHKEYPDLMVGKKIMYNHGFCSAASSGTVSLIRQTFPKANVVAWDI
PLHPAEAIDMLRKKVEEEKPDLIIGTSMGGMYTELLYGVDRICVNPAFEM
AKTMKENGLTGKQIWQNPRQDGEKEFMVNKALEKEYAEMTAQCFTALETM
TAEEQAREQQHVWGLFGDADPVVHTWDLFCSHYTQAAHFHGAHRMDDKSF
LNGVVPVIRWIDDRQEGRERPIVYIDSSTLSDAYDHPVSSLQKAFAMLIE
TYQVYIVCPAPTNNHAVTDRWGQWIEQYLFTPAHDHVIYCNNQPLLYGDY
LISRHPSQDFMGTGIELGSDEFKTWEEVITFFERLGGQ
9bact-r5fq24: Prevotella sp. CAG:924. Uncharacterized proteinPrevotella sp. CAG:924 Show
MTNRKILFLHGFFASGACVPAQTLKAAFMGRADVMTPDLPLHPREAMDLI
ENICDSERPDVLVGNSCGSFYAQMAANTKGIPALLGNPYFMMTEFLKPRI
GQHEYKSPRANGNQKMVIDGQLIDEFAEMEAHQFDGCNPDYKAQIWGLFG
ENDTLAHFEPLFLQHYPNAYHFPGAHTPTADEVRQWYVPLVEQLLASGGQ
HTTSIDK
9bact-r5kuz7: Prevotella sp. CAG:1124. Uncharacterized proteinPrevotella sp. CAG:1124 Show
MEINYKIQFPGMMKGKKILYVHGFASSGQSGTVTKIREMIPDATVIAPDL
PLHPEEALALLKDTCAKEHPDLIIGTSMGGMYTEMLYGYDRIVVNPAFQM
GDTMLKHGMLGKNTFLNPRQDGVQEFIVTKALVEEYKQITAQCFSAVTPE
ERDSRVFGLFGDADPVVHTMELFAEHYRNAISFHGEHRMNDTVLLHSVIP
VIQWIDDRQEGRTRPVIYVGIDTLRDRYGKQQSSAMKAYRTLLENYTMYV
VAQSPTNDTKYISDVASWVQDVVNVPAWNHLVFTNRLDLLYGDYLIEPSD
DFGAADFVGTRIRFGDDTFKTWEEIIEFFGRLGGQ
9bact-r5ly73: Prevotella sp. CAG:1185. Uncharacterized proteinPrevotella sp. CAG:1185 Show
MINMNKKILFLHGFFASGKCVPALSLKEAFENRADVITPDLPIHPKEAMN