Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acar-a0a1e1x355

Amblyomma aureolatum. Carboxylic ester hydrolase

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Amblyomma aureolatum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Chelicerata: N E > Arachnida: N E > Acari: N E > Parasitiformes: N E > Ixodida: N E > Ixodoidea: N E > Ixodidae: N E > Amblyomminae: N E > Amblyomma: N E > Amblyomma aureolatum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GFAC01005520
1 UniProt : A0A1E1X355
1 UniProt : A0A1E1X355
1 Interpro : A0A1E1X355
1 Prodom : A0A1E1X355
1 Pfam : A0A1E1X355
1 PIRSF : A0A1E1X355
1 SUPERFAM : A0A1E1X355
Sequence
Graphical view for this peptide sequence: 9acar-a0a1e1x355
Colored MSA for ACHE (raw)
ESAMLQKNSQLLLAAVFALLASCGAILLCLTALQQENARYNLVESQDDKP
EIVVHTAMGRVKGFISISSQGKPVRVFYGIPYAEPPIGMLRFCRPHPKDP
WTGVFNATVKPNSCVQTVDETYGNFSGSVMWNANTNMSEDCLKLNVWTPV
PPGKEPLAVLIWIYGGGFYSGTSTLDVYDARTLVSEENVIVVSMNYRVAS
LGFLSFDNELLPGNAGLYDQHMALEWVRDNIAAFGGDPNRVTLFGESAGA
ASVAMHVLSPLSRGLFKRAALQSASAIGPWIFQRNDTARKAARRLAHALG
CPTDLDNKTLNCLRDKDAKEIVYNEPHNGGIIDVPFFPVADGAFLPDSPR
VLIAQKAFQSNISVILGSNLNEGSYFLQYFFGFSEQEQNPNVTEDSFTAA
VEALNPLLGKPPMADVLKQYTNSAVPMESKDRLAALDSIVGDYHFTCPVV
QWADSFMQAGVPVYEYVFACRSSRDPWPQWTGVIHGAEVAFVFGEPFNAT
LGYSDEDKAVSGRLMRYWANFAKTGDPNLPENGTPDNTAWPRRTQPNREH
LVLTVNDTVGRAHRVEYCEFWDSIRHNWTASSPSH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ESAMLQKNSQLLLAAVFALLASCGAILLCLTALQQENARYNLVESQDDKP
EIVVHTAMGRVKGFISISSQGKPVRVFYGIPYAEPPIGMLRFCRPHPKDP
WTGVFNATVKPNSCVQTVDETYGNFSGSVMWNANTNMSEDCLKLNVWTPV
PPGKEPLAVLIWIYGGGFYSGTSTLDVYDARTLVSEENVIVVSMNYRVAS
LGFLSFDNELLPGNAGLYDQHMALEWVRDNIAAFGGDPNRVTLFGESAGA
ASVAMHVLSPLSRGLFKRAALQSASAIGPWIFQRNDTARKAARRLAHALG
CPTDLDNKTLNCLRDKDAKEIVYNEPHNGGIIDVPFFPVADGAFLPDSPR
VLIAQKAFQSNISVILGSNLNEGSYFLQYFFGFSEQEQNPNVTEDSFTAA
VEALNPLLGKPPMADVLKQYTNSAVPMESKDRLAALDSIVGDYHFTCPVV
QWADSFMQAGVPVYEYVFACRSSRDPWPQWTGVIHGAEVAFVFGEPFNAT
LGYSDEDKAVSGRLMRYWANFAKTGDPNLPENGTPDNTAWPRRTQPNREH
LVLTVNDTVGRAHRVEYCEFWDSIRHNWTASSPSH


Reference
    Title: The Distinct Transcriptional Response of the Midgut of Amblyomma sculptum and Amblyomma aureolatum Ticks to Rickettsia rickettsii Correlates to Their Differences in Susceptibility to Infection
    Martins LA, Galletti M, Ribeiro JM, Fujita A, Costa FB, Labruna MB, Daffre S, Fogaca AC
    Ref: Front Cell Infect Microbiol, 7:129, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer