Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acar-g3mp42

Amblyomma maculatum (Gulf Coast tick). Uncharacterized protein

Relationship
Family|SERHL
Block| X
Position in NCBI Life Tree|Amblyomma maculatum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Chelicerata: N E > Arachnida: N E > Acari: N E > Parasitiformes: N E > Ixodida: N E > Ixodoidea: N E > Ixodidae: N E > Amblyomminae: N E > Amblyomma: N E > Amblyomma maculatum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : JO843643
1 UniProt : G3MP42
1 UniProt : G3MP42
1 Interpro : G3MP42
1 Pfam : G3MP42
1 PIRSF : G3MP42
1 SUPERFAM : G3MP42
Sequence
Graphical view for this peptide sequence: 9acar-g3mp42
Colored MSA for SERHL (raw)
MPTECTEFKFTVPYGSLAAKLWGDAARATTRILALHGWRNNAGTFDTLIP
LLAPDMYVVALDLSGHGLSSHKPVGCSYSYHEYVMDVCRVVQQLKWDRFC
IMGHSFGCTVGMMYASFFPDRVQCVVALDLYAPLHVPRERLSQDTGKLMS
SFIHLEAKLGQPPSYTEEELLKRLDEATRHTLNDDTMRILMARDVVPDDS
DSGKLKLRTDQRTKVISTVLLDADSQYTLMEKLRCDLLMITASEIDERIM
RQSMDRFFALYKRCCPRFKHVEVEGNHYVHLNHPERVAPLINEFLAGITS
K
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPTECTEFKFTVPYGSLAAKLWGDAARATTRILALHGWRNNAGTFDTLIP
LLAPDMYVVALDLSGHGLSSHKPVGCSYSYHEYVMDVCRVVQQLKWDRFC
IMGHSFGCTVGMMYASFFPDRVQCVVALDLYAPLHVPRERLSQDTGKLMS
SFIHLEAKLGQPPSYTEEELLKRLDEATRHTLNDDTMRILMARDVVPDDS
DSGKLKLRTDQRTKVISTVLLDADSQYTLMEKLRCDLLMITASEIDERIM
RQSMDRFFALYKRCCPRFKHVEVEGNHYVHLNHPERVAPLINEFLAGITS
K


Reference
    Title: A deep insight into the sialotranscriptome of the gulf coast tick, Amblyomma maculatum
    Karim S, Singh P, Ribeiro JM
    Ref: PLoS ONE, 6:e28525, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer