Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acar-g3mrp9

Amblyomma maculatum (Gulf Coast tick), Amblyomma triste, Putative uncharacterized protein

Comment
Othe rstrains: Amblyomma maculatum (Gulf Coast tick),Amblyomma triste


Relationship
Family|Cholinesterase-like
Block| C
Position in NCBI Life Tree|Amblyomma maculatum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Chelicerata: N E > Arachnida: N E > Acari: N E > Parasitiformes: N E > Ixodida: N E > Ixodoidea: N E > Ixodidae: N E > Amblyomminae: N E > Amblyomma: N E > Amblyomma maculatum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : JO844550, GBBM01001415
2 UniProt : G3MRP9, A0A023GLM7
2 UniProt : G3MRP9, A0A023GLM7
2 Interpro : G3MRP9, A0A023GLM7
2 Pfam : G3MRP9, A0A023GLM7
2 PIRSF : G3MRP9, A0A023GLM7
2 SUPERFAM : G3MRP9, A0A023GLM7
Sequence
Graphical view for this peptide sequence: 9acar-g3mrp9
Colored MSA for Cholinesterase-like (raw)
MMPLVSTAVIIGIAMAVADPVVETDNGKILGSTVKVFNGTKEVDAFLGIP
YAKPPIGELRFKHSVPAPPWAPYTLQATKKGSACMQFTPSNPVPAWVETE
NGKSEDCLYLNVWRPHPKENDTKTLKSVMVWIHGGGFDFGSASMDLYDGA
VIAAMGDVVVVSMNYRLGVFGFLALPNDVTPSLGNQGLQDQVLALKWVQQ
HIARFGGDPKNVTLFGESAGGWSVGFHAISPVAHSLFNRAIIQSGGVLVG
QLADPFSDAERKALQLADSVGCVVGNKSNVVNCLQNKTAHHLVIMQSIVC
SQYLMCFTAVYGDEYLPHDPLKSANVSMPKEYLLGNVENEGAVFASLRFW
MQFPFRRALDVSKKDMLYFFLKTFSFAPSFVANAVYKLYVGALGEEDYVK
LRSELGNAIGDAFLRCPEVFFGEKLSKHESRVYYYNMVYHTSSRKHFDAW
LGMTHFDDVQYVFGVPLRDCPPRRYSQADAEFSRKVINIWTTFSKTGIPP
PVQGSPWPLFDVKEHKVVRLDNNCSTVETLKELERCRFWEMLSKPNLQGN
LLDCF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMPLVSTAVIIGIAMAVADPVVETDNGKILGSTVKVFNGTKEVDAFLGIP
YAKPPIGELRFKHSVPAPPWAPYTLQATKKGSACMQFTPSNPVPAWVETE
NGKSEDCLYLNVWRPHPKENDTKTLKSVMVWIHGGGFDFGSASMDLYDGA
VIAAMGDVVVVSMNYRLGVFGFLALPNDVTPSLGNQGLQDQVLALKWVQQ
HIARFGGDPKNVTLFGESAGGWSVGFHAISPVAHSLFNRAIIQSGGVLVG
QLADPFSDAERKALQLADSVGCVVGNKSNVVNCLQNKTAHHLVIMQSIVC
SQYLMCFTAVYGDEYLPHDPLKSANVSMPKEYLLGNVENEGAVFASLRFW
MQFPFRRALDVSKKDMLYFFLKTFSFAPSFVANAVYKLYVGALGEEDYVK
LRSELGNAIGDAFLRCPEVFFGEKLSKHESRVYYYNMVYHTSSRKHFDAW
LGMTHFDDVQYVFGVPLRDCPPRRYSQADAEFSRKVINIWTTFSKTGIPP
PVQGSPWPLFDVKEHKVVRLDNNCSTVETLKELERCRFWEMLSKPNLQGN
LLDCF



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer