Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9actn-a0a0g3utb4

Streptomyces sp. Mg1. Carboxylic ester hydrolase

Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Streptomyces sp. Mg1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces sp. Mg1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP011664
1 UniProt : A0A0G3UTB4
1 UniProt : A0A0G3UTB4
1 Interpro : A0A0G3UTB4
1 Pfam : A0A0G3UTB4
1 PIRSF : A0A0G3UTB4
1 SUPERFAM : A0A0G3UTB4
Sequence
Graphical view for this peptide sequence: 9actn-a0a0g3utb4
Colored MSA for Carb_B_Bacteria (raw)
MRAPSGRPRAGTGYGVVEGRREAGGIAVFRGIPYAAPPVGALRFAAPAPP
EPWEGVRDAGAFGPTAPKVPYPDTFAALLPDPEIPGDDCLNLNVWTPDPD
PGARLPVMVWIHGGALTRGSAAVPVYDGAAFARDGVVLVSFNYRLGALGY
GLFPDAPANRGLLDQIAALTWVRDNIEAFGGDPGRVTVFGESAGAISIGA
LLAAPRAAGLFTRAVLQSGAPEVLPRDRVRTMVRRMAALLKVPATAGAFT
AVALPDLLRAQAAVLRRTNSLVGGPAFGLVADPATLPDDPLEAAAAGEVP
LLLGWTAEEYRLWLAPTGAMRVLDRLGPLAVSLARARSGKDRATVRALRT
ALPGASAAELAGQLLTDRLLRDPLRRLAGARRSAPSHLYEFRWRSGVPGL
GSCHALELGFVFDTLHVPEAAWLAGRDTPQELADEMHAAWVRFAVTGDPG
WAPWDGSGPPKVFGGPEREGEALAATPPVLP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRAPSGRPRAGTGYGVVEGRREAGGIAVFRGIPYAAPPVGALRFAAPAPP
EPWEGVRDAGAFGPTAPKVPYPDTFAALLPDPEIPGDDCLNLNVWTPDPD
PGARLPVMVWIHGGALTRGSAAVPVYDGAAFARDGVVLVSFNYRLGALGY
GLFPDAPANRGLLDQIAALTWVRDNIEAFGGDPGRVTVFGESAGAISIGA
LLAAPRAAGLFTRAVLQSGAPEVLPRDRVRTMVRRMAALLKVPATAGAFT
AVALPDLLRAQAAVLRRTNSLVGGPAFGLVADPATLPDDPLEAAAAGEVP
LLLGWTAEEYRLWLAPTGAMRVLDRLGPLAVSLARARSGKDRATVRALRT
ALPGASAAELAGQLLTDRLLRDPLRRLAGARRSAPSHLYEFRWRSGVPGL
GSCHALELGFVFDTLHVPEAAWLAGRDTPQELADEMHAAWVRFAVTGDPG
WAPWDGSGPPKVFGGPEREGEALAATPPVLP


Reference
    Title: De Novo Assembly of the Streptomyces sp. Strain Mg1 Genome Using PacBio Single-Molecule Sequencing
    Hoefler BC, Konganti K, Straight PD
    Ref: Genome Announc, 1:, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer