Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9actn-a0a0h4clb1

Streptomyces sp. Hydrolase

Comment
c-term Cellulose binding domain 295. Other strains: Streptomyces sp. PBH53


Relationship
Family|FaeC
Block| X
Position in NCBI Life Tree|Streptomyces sp. PBH53
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces sp. PBH53: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP011799, WP_059255336
1 UniProt : A0A0H4CLB1
2 UniProt : A0A0H4CLB1, A0A255PW78
2 Interpro : A0A0H4CLB1, A0A255PW78
2 Prodom : A0A0H4CLB1, A0A255PW78
2 Pfam : A0A0H4CLB1, A0A255PW78
2 PIRSF : A0A0H4CLB1, A0A255PW78
2 SUPERFAM : A0A0H4CLB1, A0A255PW78
Sequence
Graphical view for this peptide sequence: 9actn-a0a0h4clb1
Colored MSA for FaeC (raw)
MLIVLSTGGTALGRDRSGNTPPTAPRTAAATAAPSSGCGKTPTLTSGTHT
IRSGGKNRTFILRIPGGYDRSRPYRLVLGFHWWGGTSTDVATGRTVETGT
WAYYGLQRLANDSAVFVAPQGLDNGWANAGGEDVTFVDDMLRRIESDLCV
DTTQRFALGFSYGAAMSYALACSRATVFRAVAIQSGGQLSGCSGGTQPIA
YFGVHGLRDSVLGISGGRAMRDRFVRNNGCTPQNPPEPAQGSLTHRVTAY
SGCSAGHPVAWAAFDEGHIAAPQDGAPGDSGSRTWLPGEVWTFFT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLIVLSTGGTALGRDRSGNTPPTAPRTAAATAAPSSGCGKTPTLTSGTHT
IRSGGKNRTFILRIPGGYDRSRPYRLVLGFHWWGGTSTDVATGRTVETGT
WAYYGLQRLANDSAVFVAPQGLDNGWANAGGEDVTFVDDMLRRIESDLCV
DTTQRFALGFSYGAAMSYALACSRATVFRAVAIQSGGQLSGCSGGTQPIA
YFGVHGLRDSVLGISGGRAMRDRFVRNNGCTPQNPPEPAQGSLTHRVTAY
SGCSAGHPVAWAAFDEGHIAAPQDGAPGDSGSRTWLPGEVWTFFT


Reference
    Title: Draft Genome Sequence of Streptomyces sp. Strain PBH53, Isolated from an Urban Environment
    Gosse JT, Hill P, Dowd SE, Boddy CN
    Ref: Genome Announc, 3:, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer