Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9actn-a0a1i5y3q1

Actinomadura madurae. 3HB-oligomer hydrolase (3HBOH)

Relationship
Family|OHBut_olig_hydro_put
Block| X
Position in NCBI Life Tree|Actinomadura madurae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptosporangiales: N E > Thermomonosporaceae: N E > Actinomadura: N E > Actinomadura madurae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : FOVH01000029, WP_075024820.1
1 UniProt : A0A1I5Y3Q1
1 UniProt : A0A1I5Y3Q1
1 Interpro : A0A1I5Y3Q1
1 Prodom : A0A1I5Y3Q1
1 Pfam : A0A1I5Y3Q1
1 PIRSF : A0A1I5Y3Q1
1 SUPERFAM : A0A1I5Y3Q1
Sequence
Graphical view for this peptide sequence: 9actn-a0a1i5y3q1
Colored MSA for OHBut_olig_hydro_put (raw)
MPLLRRSPVLPALLGSLLAVPLAVAVPSAHADARCAHMNRVRVPGAVHQV
AACLDDLTTAGTVASGHTDKSDWEGLHSAATRNPSGVPGIQIDGYFRDDS
SFNTTHGWNHDSQFVIRLPKRWNGGLVVSGAPGTRRQYANDFTISDWVLS
KGYAFASTDKGSNGNQFYRDGKRPGDAVAEWYRRMIQVTVAAKATVARHY
GRRLTRTYAAGISNGGQMVRWALENHPELYDGGVDSEGTYWPRDNGNNAL
VYLPEALRNYPAYAATGDPIAHAAMLKAGFAPGSEFLWDFNYRFIWDNTQ
RIYREEVDPAYDGDLEAGIPYCESGTPNCDTDYRYYSRPRSVHRTVARLG
MTGRIGKPMITVQGTLDTLLPIKVHGDAYARKIRAQGRGGLHRYYRIEGA
SHLDLEYDLFPGRMRPLLPCMRTAFEALERWVGPGGGQAPPPSATIPRQT
SGDVVNTCAIG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPLLRRSPVLPALLGSLLAVPLAVAVPSAHADARCAHMNRVRVPGAVHQV
AACLDDLTTAGTVASGHTDKSDWEGLHSAATRNPSGVPGIQIDGYFRDDS
SFNTTHGWNHDSQFVIRLPKRWNGGLVVSGAPGTRRQYANDFTISDWVLS
KGYAFASTDKGSNGNQFYRDGKRPGDAVAEWYRRMIQVTVAAKATVARHY
GRRLTRTYAAGISNGGQMVRWALENHPELYDGGVDSEGTYWPRDNGNNAL
VYLPEALRNYPAYAATGDPIAHAAMLKAGFAPGSEFLWDFNYRFIWDNTQ
RIYREEVDPAYDGDLEAGIPYCESGTPNCDTDYRYYSRPRSVHRTVARLG
MTGRIGKPMITVQGTLDTLLPIKVHGDAYARKIRAQGRGGLHRYYRIEGA
SHLDLEYDLFPGRMRPLLPCMRTAFEALERWVGPGGGQAPPPSATIPRQT
SGDVVNTCAIG



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer