Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9actn-a0a2p9i3n2

Actinomadura parvosata subsp. kistnae; Nonomuraea sp.. Endo-1,4-beta-xylanase A

Comment
c-term Ricin B-type lectin excluded. Other strains: Nonomuraea sp.; Actinomadura parvosata subsp.


Relationship
Family|FaeC
Block| X
Position in NCBI Life Tree|Actinomadura parvosata subsp. kistnae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptosporangiales: N E > Thermomonosporaceae: N E > Actinomadura: N E > Actinomadura parvosata: N E > Actinomadura parvosata subsp. kistnae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : OOHJ01000009
1 UniProt : A0A2P9I3N2
2 UniProt : A0A2P9I3N2, A0A1V0AJE4
2 Interpro : A0A2P9I3N2, A0A1V0AJE4
2 Prodom : A0A2P9I3N2, A0A1V0AJE4
2 Pfam : A0A2P9I3N2, A0A1V0AJE4
2 PIRSF : A0A2P9I3N2, A0A1V0AJE4
2 SUPERFAM : A0A2P9I3N2, A0A1V0AJE4
Sequence
Graphical view for this peptide sequence: 9actn-a0a2p9i3n2
Colored MSA for FaeC (raw)
MMSRLRLFLTAVFSAVLLIVPAAAQTAMAQTAMAGPTAGCGKTPTLRSGS
QSITTSGKNRSFILRIPDNYSNTTPYRLIFGFHWNGGTAGDVDSGGTSGY
PWSYYGLRALSNNTAIFVAPQGLGNGWANSGGEDITFVDDMIRRIEADLC
VDTTQRFAMGFSYGGGMSYALACARASVFRAVAVYSGAQLSGCSGGTEPV
AYIGLHGLRDPVLNISAGRSLRDRFVRNNGCTAQNPPEPAQGSLTHVVTY
YSGCRSGYPVAWAAFDAGHTPNPVDGRPGDYEPGENSWTRPVVWDFF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMSRLRLFLTAVFSAVLLIVPAAAQTAMAQTAMAGPTAGCGKTPTLRSGS
QSITTSGKNRSFILRIPDNYSNTTPYRLIFGFHWNGGTAGDVDSGGTSGY
PWSYYGLRALSNNTAIFVAPQGLGNGWANSGGEDITFVDDMIRRIEADLC
VDTTQRFAMGFSYGGGMSYALACARASVFRAVAVYSGAQLSGCSGGTEPV
AYIGLHGLRDPVLNISAGRSLRDRFVRNNGCTAQNPPEPAQGSLTHVVTY
YSGCRSGYPVAWAAFDAGHTPNPVDGRPGDYEPGENSWTRPVVWDFF



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer