Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9actn-f1cla7

Streptomyces chattanoogensis Pimaricin type I polyene PKS scnS4 thioesterase domain PimTE Pim-TE

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces chattanoogensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces chattanoogensis: N E


Molecular evidence
Database
No mutation
2 structures: 7VO4, 7VO5
No kinetic





2 substrates: Pimaricin, Pimaricin-linear-analogue-synthetic
1 inhbitor:
4d-81E-7VO5
1 Genbank : ADX66459
1 UniProt : F1CLA7
2 Structure : 7VO4, 7VO5
1 UniProt : F1CLA7
1 Interpro : F1CLA7
1 Pfam : F1CLA7
1 PIRSF : F1CLA7
1 SUPERFAM : F1CLA7
Sequence
Graphical view for this peptide sequence: 9actn-f1cla7
Colored MSA for Thioesterase (raw)
FLPAAAPETDSLERMFLDALESGRIPEAQRMLSALGALRPSFENTAELED
LPLPATLAEGPGAPRLICVSTPTANGGVHEYARLAASFRGERHVSALPLV
GFAAGERLPATPETAVRVVAESTLRASDGNPFVLVGHSSAGAFAYLAAAL
LENTWGIRPEAVVLLDTLSLRHEQNETIDYAGLMRRHFMVDEVSPVRMTN
SRLSAMARWMGMLNQLEVRHTTVPVLIIRAAKETFGIGTDTGIYGEDHGS
PVDVRSVDADHFSMVRDDAPETARIVKEWLDSLGNA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

FLPAAAPETDSLERMFLDALESGRIPEAQRMLSALGALRPSFENTAELED
LPLPATLAEGPGAPRLICVSTPTANGGVHEYARLAASFRGERHVSALPLV
GFAAGERLPATPETAVRVVAESTLRASDGNPFVLVGHSSAGAFAYLAAAL
LENTWGIRPEAVVLLDTLSLRHEQNETIDYAGLMRRHFMVDEVSPVRMTN
SRLSAMARWMGMLNQLEVRHTTVPVLIIRAAKETFGIGTDTGIYGEDHGS
PVDVRSVDADHFSMVRDDAPETARIVKEWLDSLGNA


Reference
    Title: Structural and Mechanistic Insights into Chain Release of the Polyene PKS Thioesterase Domain
    Zhou Y, Tao W, Qi Z, Wei J, Shi T, Kang Q, Zheng J, Zhao Y, Bai L
    Ref: ACS Catal, 12:762, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer