Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-b0i4w7

Nocardioides sp. DF412 2-hydroxy-6-(2-hydroxyphenyl)-6-oxo-2,4 hexadienoic acid hydrolase

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Nocardioides sp. DF412
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Nocardioidaceae: N E > Nocardioides: N E > Nocardioides sp. DF412: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB373749
1 UniProt : B0I4W7
1 UniProt : B0I4W7
1 Interpro : B0I4W7
1 Prodom : B0I4W7
1 Pfam : B0I4W7
1 PIRSF : B0I4W7
1 SUPERFAM : B0I4W7
Sequence
Graphical view for this peptide sequence: 9acto-b0i4w7
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MTLDPHSISKTVRTKDWSIHYNEAGPADGHPVVLLHGGGPGATGWSNYSP
NIEALARHFRVIAPDMPGWGDSDAVDFATLDHVEALCQLLDQLGIERAAL
VGNSMGGHTSIRTAIERPERVSHLITMGAPLQMKPILFGAGGGPSEGLKI
MYAGFGDASPAAMRRLVEIMVFDQARFATPELCEQRSQAALKRPEHLANI
AKAAPRAPIPIWADPARLGEITAPALLVHGRDDRVVTFETALFLAANIPD
SRAHLINRCGHWAQLEHADEFNRLVTDFVLNH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTLDPHSISKTVRTKDWSIHYNEAGPADGHPVVLLHGGGPGATGWSNYSP
NIEALARHFRVIAPDMPGWGDSDAVDFATLDHVEALCQLLDQLGIERAAL
VGNSMGGHTSIRTAIERPERVSHLITMGAPLQMKPILFGAGGGPSEGLKI
MYAGFGDASPAAMRRLVEIMVFDQARFATPELCEQRSQAALKRPEHLANI
AKAAPRAPIPIWADPARLGEITAPALLVHGRDDRVVTFETALFLAANIPD
SRAHLINRCGHWAQLEHADEFNRLVTDFVLNH


Reference
    Title: Isolation of dibenzofuran-degrading bacterium, Nocardioides sp. DF412, and characterization of its dibenzofuran degradation genes
    Miyauchi K, Sukda P, Nishida T, Ito E, Matsumoto Y, Masai E, Fukuda M
    Ref: J Biosci Bioeng, 105:628, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer