Gene_locus Report for: 9acto-b5hmc1Streptomyces sviceus ATCC 29083 Hydrolase Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces sviceus: N E > Streptomyces sviceus ATCC 29083: N E
6_AlphaBeta_hydrolase : 9acto-b5hpa2Streptomyces sviceus ATCC 29083 Oxidoreductase, 9acto-b5ht96Streptomyces sviceus ATCC 29083 Putative uncharacterized protein, 9acto-b5hut5Streptomyces sviceus ATCC 29083 Putative uncharacterized protein, 9acto-b5hzh3Streptomyces sviceus ATCC 29083 Hydrolase, 9acto-b5i652Streptomyces sviceus ATCC 29083 Secreted protein. A85-Est-Putative : 9acto-b5hmd3Streptomyces sviceus ATCC 29083 Putative uncharacterized protein, 9acto-b5hy25Streptomyces sviceus ATCC 29083 Putative uncharacterized protein, 9acto-b5hye5Streptomyces sviceus ATCC 29083 Putative uncharacterized protein. A85-IroE-IroD-Fes-Yiel : 9acto-b5hz37Streptomyces sviceus ATCC 29083 Putative uncharacterized protein. Acetyl-esterase_deacetylase : 9acto-b5htd2Streptomyces sviceus ATCC 29083 Acetyl xylan esterase, 9acto-d6xc88Streptomyces sviceus ATCC 29083 Esterase. Aclacinomycin-methylesterase_RdmC : 9acto-b5hp47Streptomyces sviceus ATCC 29083 Putative uncharacterized protein. Carboxymethylbutenolide_lactonase : 9acto-b5hsp7Streptomyces sviceus ATCC 29083 3-oxoadipate enol-lactonase. Carb_B_Bacteria : 9acto-b5hlj5Streptomyces sviceus ATCC 29083 Para-nitrobenzyl esterase, 9acto-b5hpi0Streptomyces sviceus ATCC 29083 Carboxylesterase, 9acto-b5hra6Streptomyces sviceus; Streptomyces pseudovenezuelae, Phenmedipham hydrolase, 9acto-b5hvq6Streptomyces sviceus ATCC 29083 Putative uncharacterized protein, 9acto-b5i3r5Streptomyces sviceus ATCC 29083 Carboxylesterase. CFTR-inhibitory-factor_Cif : 9acto-b5hut8Streptomyces sviceus ATCC 29083 Hydrolase. DPP4N_Peptidase_S9 : 9acto-b5hxt3Streptomyces sviceus ATCC 29083 Peptidase. Duf_1023 : 9acto-b5hvu2Streptomyces sviceus ATCC 29083 Putative uncharacterized protein, 9acto-b5i2l6Streptomyces sviceus ATCC 29083 Secreted protein. Epoxide_hydrolase : 9acto-b5hl58Streptomyces sviceus ATCC 29083 Epoxide hydrolase, 9acto-b5hvi9Streptomyces sviceus ATCC 29083 Hydrolase, 9acto-b5i2q2Streptomyces sviceus ATCC 29083 Epoxide hydrolase, 9acto-b5i5i8Streptomyces sviceus ATCC 29083 Oxidoreductase, 9acto-b5i653Streptomyces sviceus ATCC 29083 Alpha/beta hydrolase. Est9X : 9acto-b5hvu3Streptomyces sviceus ATCC 29083 Lipase/esterase. FaeC : 9actn-b5hz21Streptomyces sviceus ATCC 29083. Cellulase, 9actn-b5i426Streptomyces sviceus ATCC 29083. Cellulase. Fungal-Bact_LIP : 9acto-b5i228Streptomyces sviceus ATCC 29083 Triacylglycerol lipase. Haloacetate_dehalogenase : 9acto-b5i1i1Streptomyces sviceus ATCC 29083 Hydrolase. Haloperoxidase : 9acto-b5i816Streptomyces sviceus ATCC 29083 Alpha/beta hydrolase. HNLyase_Bact : 9acto-b5hpm9Streptomyces sviceus ATCC 29083 Esterase, 9acto-b5hrv8Streptomyces sviceus ATCC 29083 Esterase, 9acto-b5hzq5Streptomyces sviceus ATCC 29083 Esterase, 9acto-b5i478Streptomyces sviceus ATCC 29083 Esterase. Lipase_2 : 9acto-b5i8e9Streptomyces sviceus ATCC 29083 Lipase. Monoglyceridelipase_lysophospholip : 9acto-b5hwd4Streptomyces sviceus ATCC 29083 Lipase. NLS3-Tex30 : 9acto-b5hn43Streptomyces sviceus ATCC 29083 Putative uncharacterized protein. Peptidase_S37 : 9acto-b5hne2Streptomyces sviceus; Streptomyces sp.; Streptomyces canus; Actinoplanes awajinensis subsp.; Streptomyces griseorubiginosus; Streptomyces pseudovenezuelae Secreted tripeptidyl aminopeptidase. Proline_iminopeptidase : 9acto-b5i5a9Streptomyces sviceus ATCC 29083 Proline imino-peptidase, 9acto-b5hz62Streptomyces sviceus ATCC 29083. Prolyl aminopeptidase. RsbQ-like : 9acto-b5i917Streptomyces sviceus ATCC 29083 Hydrolase. Tannase_Bact : 9acto-b5hl76Streptomyces sviceus ATCC 29083 Putative uncharacterized protein
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: 9acto-b5hmc1 Colored MSA for 6_AlphaBeta_hydrolase (raw)
MDKKTLSRDGTPIAYARTGQGPAVILVSGAMSTGGTVAPLAVPLSERFDV
LVYDRRGRGASGDTAPYAVAREVDDLAALIETAGGEASLCGVSSGGALVL
EAAASGLPVRRVAVYETPFADFLDGGAEGNAEYTRRLDAALAEGRRGDAV
ELFLRLTGMGEEMIQGARQSPMWPGMEAVAPTLAYDNAVMAGGLVPRDRL
ASITVPVLAVAGGASPEWMREGTRAVAEAAPKGSYRVLEGQTHMVDPTAL
APVLTEFFTD
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MDKKTLSRDGTPIAYARTGQGPAVILVSGAMSTGGTVAPLAVPLSERFDV LVYDRRGRGASGDTAPYAVAREVDDLAALIETAGGEASLCGVSSGGALVL EAAASGLPVRRVAVYETPFADFLDGGAEGNAEYTRRLDAALAEGRRGDAV ELFLRLTGMGEEMIQGARQSPMWPGMEAVAPTLAYDNAVMAGGLVPRDRL ASITVPVLAVAGGASPEWMREGTRAVAEAAPKGSYRVLEGQTHMVDPTAL APVLTEFFTD
|
|
|