Gene_locus Report for: 9acto-d0wq88Actinomyces sp. oral taxon 848 str. F0332 Putative uncharacterized protein Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Actinomycetales: N E > Actinomycetaceae: N E > Actinomyces: N E > Actinomyces sp. oral taxon 848: N E > Actinomyces sp. oral taxon 848 str. F0332: N E
6_AlphaBeta_hydrolase : 9acto-d0wrf5Actinomyces sp. oral taxon 848 str. F0332 Alpha/beta hydrolase family protein. A85-Est-Putative : 9acto-d0wnv3Actinomyces sp. oral taxon 848 str. F0332 Esterase family protein, 9acto-d0wpr3Actinomyces sp. oral taxon 848 str. F0332 Esterase family protein. A85-Feruloyl-Esterase : 9acto-d0wnr1Actinomyces sp. oral taxon 848 str. F0332 Putative endo-1,4-beta-xylanase Y. A85-IroE-IroD-Fes-Yiel : 9acto-d0ws19Actinomyces sp. oral taxon 848 str. F0332 Putative enterochelin esterase. CFTR-inhibitory-factor_Cif : 9acto-d0wjx8Actinomyces sp. oral taxon 848 str. F0332 Epoxide hydrolase. Duf_1023 : 9acto-d0wju6Actinomyces sp. oral taxon 848 str. F0332 Putative uncharacterized protein, 9acto-d0wk94Actinomyces sp. oral taxon 848 str. F0332 Putative uncharacterized protein, 9acto-d0wl70Actinomyces sp. oral taxon 848 str. F0332 Putative uncharacterized protein, 9acto-d0wlk2Actinomyces sp. oral taxon 848 str. F0332 Putative uncharacterized protein, 9acto-d0wlx6Actinomyces sp. oral taxon 848 str. F0332 Putative uncharacterized protein, 9acto-d0wma3Actinomyces sp. oral taxon 848 str. F0332 Putative uncharacterized protein, 9acto-d0wqf3Actinomyces sp. oral taxon 848 str. F0332 Putative uncharacterized protein, 9acto-d0wr08Actinomyces sp. oral taxon 848 str. F0332 Putative uncharacterized protein. Epoxide_hydrolase : 9acto-d0wk53Actinomyces sp. oral taxon 848 str. F0332 Alpha/beta hydrolase family protein. Monoglyceridelipase_lysophospholip : 9acto-d0wk88Actinomyces sp. oral taxon 848 str. F0332 Hydrolase, alpha/beta fold family domain protein, 9acto-d0wmb4Actinomyces sp. oral taxon 848 str. F0332 Hydrolase, alpha/beta fold family domain protein. Proline_iminopeptidase : 9acto-d0wl80Actinomyces sp. oral taxon 848 str. F0332. Hydrolase, alpha/beta domain protein
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: 9acto-d0wq88 Colored MSA for 6_AlphaBeta_hydrolase (raw)
MTWLILPGWGLPPKDYEKLAGLLGPGTRTLDSWKVPLTADTDDIRAELGA
SDSPKVDLLGHSLGGLAAIEWALRRPDQIGQLVLIDPTAPDEVPSRFHVE
GKLRRGMDKLAGAAVEALWRVGPRIRRWGIRQTTGSEDTLPIDEARARYG
TRENSRRLAEQLSTSWEHAARVDALLDADVVRRRSPAPLLLVGAGNGKQR
RFLRSQWDLGRKLHARTIMLTGQNHVFPLTRPDLVVRHIQSQ
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MTWLILPGWGLPPKDYEKLAGLLGPGTRTLDSWKVPLTADTDDIRAELGA SDSPKVDLLGHSLGGLAAIEWALRRPDQIGQLVLIDPTAPDEVPSRFHVE GKLRRGMDKLAGAAVEALWRVGPRIRRWGIRQTTGSEDTLPIDEARARYG TRENSRRLAEQLSTSWEHAARVDALLDADVVRRRSPAPLLLVGAGNGKQR RFLRSQWDLGRKLHARTIMLTGQNHVFPLTRPDLVVRHIQSQ
|
|
|