Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-h1qtl0

Streptomyces coelicoflavus ZG0656 Lipase/esterase

Relationship
Family|Est9X
Block| H
Position in NCBI Life Tree|Streptomyces coelicoflavus ZG0656
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces coelicoflavus: N E > Streptomyces coelicoflavus ZG0656: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Paranitrophenylacetate
No inhibitor
2 Genbank : AHGS01001565, KPC70032
1 UniProt : H1QTL0
1 UniProt : H1QTL0
1 Interpro : H1QTL0
1 Prodom : H1QTL0
1 Pfam : H1QTL0
1 PIRSF : H1QTL0
1 SUPERFAM : H1QTL0
Sequence
Graphical view for this peptide sequence: 9acto-h1qtl0
Colored MSA for Est9X (raw)
MPDAAAEPGTAAARNAAEEESAFSHPAVAPDSTAGYGDDPDQVVDFYAPH
DGAGPGGAAPVVVVLHGGSWRAPYDRRHISPFAGFLARRGFAVASVEYRR
GAEGTGVDGSGDPVAGRWPDTFDDVAAALDALPELVRRHLPQADVRRTVL
TGHSAGGHLALWAAARHLLPADAPWRTDRPAPLRGVVALAPIADFEVADK
LDVCGGAARQLLGEGELFAERRPYADPALLLPTGIATTLVQGRADVDVPQ
AVAEAYADAAAKAGEVVGVTLLEDVGHYPLIDPVADACAVVTEEIAQLAW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPDAAAEPGTAAARNAAEEESAFSHPAVAPDSTAGYGDDPDQVVDFYAPH
DGAGPGGAAPVVVVLHGGSWRAPYDRRHISPFAGFLARRGFAVASVEYRR
GAEGTGVDGSGDPVAGRWPDTFDDVAAALDALPELVRRHLPQADVRRTVL
TGHSAGGHLALWAAARHLLPADAPWRTDRPAPLRGVVALAPIADFEVADK
LDVCGGAARQLLGEGELFAERRPYADPALLLPTGIATTLVQGRADVDVPQ
AVAEAYADAAAKAGEVVGVTLLEDVGHYPLIDPVADACAVVTEEIAQLAW


References
    Title: Characterization of a novel hyper-thermostable and chlorpyrifos-hydrolyzing carboxylesterase EstC: A representative of the new esterase family XIX
    Wang B, Wu S, Chang X, Chen J, Ma J, Wang P, Zhu G
    Ref: Pestic Biochem Physiol, 170:104704, 2020 : PubMed

            

    Title: Draft genome sequence of Streptomyces coelicoflavus ZG0656 reveals the putative biosynthetic gene cluster of acarviostatin family alpha-amylase inhibitors
    Guo X, Geng P, Bai F, Bai G, Sun T, Li X, Shi L, Zhong Q
    Ref: Lett Appl Microbiol, 55:162, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer