Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-q1psf3

Streptomyces tsusimaensis vlm2 thioesterase domain

Comment
only c-term PfamA Thioesterase


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Streptomyces tsusimaensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces tsusimaensis: N E


Molecular evidence
Database
No mutation
5 structures (e.g. : 6ECB, 6ECC, 6ECD... more)
No kinetic





No Substrate
No inhibitor
1 Genbank : DQ174261
1 UniProt : Q1PSF3
>3 Structure links 2 more: 6ECB, 6ECC, 6ECD
1 UniProt : Q1PSF3
1 Interpro : Q1PSF3
1 Prodom : Q1PSF3
1 Pfam : Q1PSF3
1 PIRSF : Q1PSF3
1 SUPERFAM : Q1PSF3
Sequence
Graphical view for this peptide sequence: 9acto-q1psf3
Colored MSA for Thioesterase (raw)
NLYFQGGSSTAGDPTAKLVRLNPRGGDGPGIVFAPPAGGTVLGYIELARH
LKGFGEIHGVEAPGLGAGETPVYPSFEEMVQFCSDSAAGVAGDGVYIGGH
SLGGHIAFYLATMLLDRGIRPKGLIILDTPPRLGDIPVADADLTEEETKV
FILAMGIGGMLDQDRDALKDLPYEEAKQLLLDRAKNDPRVSAFLSEDYLD
RFLRLQMHQLMYSRDVVLPQRKLDIPIHVFRTKNHAPEVARLFSAWENYA
AGEVTFVDIPGDHATMLRAPHVSEVAQLLDRHCGLPSDDGPRG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

NLYFQGGSSTAGDPTAKLVRLNPRGGDGPGIVFAPPAGGTVLGYIELARH
LKGFGEIHGVEAPGLGAGETPVYPSFEEMVQFCSDSAAGVAGDGVYIGGH
SLGGHIAFYLATMLLDRGIRPKGLIILDTPPRLGDIPVADADLTEEETKV
FILAMGIGGMLDQDRDALKDLPYEEAKQLLLDRAKNDPRVSAFLSEDYLD
RFLRLQMHQLMYSRDVVLPQRKLDIPIHVFRTKNHAPEVARLFSAWENYA
AGEVTFVDIPGDHATMLRAPHVSEVAQLLDRHCGLPSDDGPRG


References
    Title: Trapping biosynthetic acyl-enzyme intermediates with encoded 2,3-diaminopropionic acid
    Huguenin-Dezot N, Alonzo DA, Heberlig GW, Mahesh M, Nguyen DP, Dornan MH, Boddy CN, Schmeing TM, Chin JW
    Ref: Nature, 565:112, 2019 : PubMed

            

    Title: Deciphering the biosynthetic codes for the potent anti-SARS-CoV cyclodepsipeptide valinomycin in Streptomyces tsusimaensis ATCC 15141
    Cheng YQ
    Ref: Chembiochem, 7:471, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer