Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-q2hwh9

Nocardioides aromaticivorans meta-cleavage compound hydrolase

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Nocardioides aromaticivorans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Nocardioidaceae: N E > Nocardioides: N E > Nocardioides aromaticivorans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB244528
1 UniProt : Q2HWH9
1 UniProt : Q2HWH9
1 Interpro : Q2HWH9
1 Prodom : Q2HWH9
1 Pfam : Q2HWH9
1 PIRSF : Q2HWH9
1 SUPERFAM : Q2HWH9
Sequence
Graphical view for this peptide sequence: 9acto-q2hwh9
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MTDVRDPGREHVVDAGGVKTRYWESGTGEPLVLIHGGGAGADARGNWSGC
FPYLTPHFRVIAYDMVGFGQSVPDNPDFAFTQPSRIDHLAAFLDALGLER
ASFVGNSMGGATALGLAMRNPERIATLTLMGSAGLTRQFSAELSTMLDYT
EPSLDGMRRIVGALTHPRYQPSEELVQYRYQLTQDNRVMDAYRATMAWIR
EQGGLFYPEEDIARVKSKTLVVSGREDQVVPLDLSVRFHQLLDNSRLCSI
AHCGHWAMLEHPDKLASAVVGFIDEEENR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTDVRDPGREHVVDAGGVKTRYWESGTGEPLVLIHGGGAGADARGNWSGC
FPYLTPHFRVIAYDMVGFGQSVPDNPDFAFTQPSRIDHLAAFLDALGLER
ASFVGNSMGGATALGLAMRNPERIATLTLMGSAGLTRQFSAELSTMLDYT
EPSLDGMRRIVGALTHPRYQPSEELVQYRYQLTQDNRVMDAYRATMAWIR
EQGGLFYPEEDIARVKSKTLVVSGREDQVVPLDLSVRFHQLLDNSRLCSI
AHCGHWAMLEHPDKLASAVVGFIDEEENR


Reference
    Title: Characterization of novel carbazole catabolism genes from gram-positive carbazole degrader Nocardioides aromaticivorans IC177
    Inoue K, Habe H, Yamane H, Nojiri H
    Ref: Applied Environmental Microbiology, 72:3321, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer