Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-q2mhh5

Gordonia sp. P8219 monoethylhexylphthalate hydrolase mehpH mphG1

Comment
other strains: (Gordonia sp. P8219; YC-JH1); Dietzia timorensis


Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Gordonia sp. P8219
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Gordoniaceae: N E > Gordonia: N E > Gordonia sp. P8219: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





3 substrates: DEHP, MEHP, Monobutyl-phthalate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9acto-q2mhh5
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MNCSIVIVHRKALSVPSSSITQKFHTVDVKGVQTRYFDDGQDKDPILLIH
GGHFGFFIPVGIESWGNVLEDFGEYGRVLAVDKLGQGETGLPLNDEDWTV
DAVAEHVANFATQLGLKNLTLVGHSRGGMTAVLLALKYPEMVKKLVIISS
ATAAPAPPVGTDMDFYERVERTAPGGSAELIRHYHAAQAVNEGDLPEDYI
GIATKWLESEKQLDAVAGYARNAEEHWLPSLSEGRRWVQERLADAGIPVP
TLVVWGVNDRSAPVSMGKGLFDLIAANTLDSSLYLINNAGHHVFSDQREK
FNAAVGAFISL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNCSIVIVHRKALSVPSSSITQKFHTVDVKGVQTRYFDDGQDKDPILLIH
GGHFGFFIPVGIESWGNVLEDFGEYGRVLAVDKLGQGETGLPLNDEDWTV
DAVAEHVANFATQLGLKNLTLVGHSRGGMTAVLLALKYPEMVKKLVIISS
ATAAPAPPVGTDMDFYERVERTAPGGSAELIRHYHAAQAVNEGDLPEDYI
GIATKWLESEKQLDAVAGYARNAEEHWLPSLSEGRRWVQERLADAGIPVP
TLVVWGVNDRSAPVSMGKGLFDLIAANTLDSSLYLINNAGHHVFSDQREK
FNAAVGAFISL


References
    Title: Excellent Degradation Performance of a Versatile Phthalic Acid Esters-Degrading Bacterium and Catalytic Mechanism of Monoalkyl Phthalate Hydrolase
    Fan S, Wang J, Yan Y, Jia Y
    Ref: Int J Mol Sci, 19:, 2018 : PubMed

            

    Title: A mono-2-ethylhexyl phthalate hydrolase from a Gordonia sp. that is able to dissimilate di-2-ethylhexyl phthalate
    Nishioka T, Iwata M, Imaoka T, Mutoh M, Egashira Y, Nishiyama T, Shin T, Fujii T
    Ref: Applied Environmental Microbiology, 72:2394, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer