Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-q2wfe0

Streptomyces albulus putative x-pro dipeptidyl-peptidase

Relationship
Family|Lactobacillus_peptidase
Block| X
Position in NCBI Life Tree|Streptomyces albulus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces albulus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB243405
1 UniProt : Q2WFE0
1 UniProt : Q2WFE0
1 Interpro : Q2WFE0
1 Pfam : Q2WFE0
1 PIRSF : Q2WFE0
1 SUPERFAM : Q2WFE0
Sequence
Graphical view for this peptide sequence: 9acto-q2wfe0
Colored MSA for Lactobacillus_peptidase (raw)
MTIRTGTPHPPWKTLVLSAALALLALVAVPGSAGAAPAPRESKPVYSYAH
AVRETVWVDTGLDGDGDGRPDRVAADIVRPAEPARQGRRIPVIMDASPYY
SCCGRGNESQKKTYDAQGRPVQFPLFYDNYFVPRGYATVLVDLAGTNRSD
GCIDVGGRSDVQSAKAVVDWLGGRARGYTARSGGKPVTADWSNGNTGMIG
KSWDATVANGVAVTGVPGLKTIVPIAGISSWYDYYFAQGAPLYDGGPDGL
ASAVESPGAHKNCAAVQKKLVDGAPRNGDWTDLWTERDYVRNADKVRASV
FLVHGMQDLNVRTKHFGQWWDALARHGVQRKIWLSQTGHVDPFDYRRADW
VRTLHQWFDHYLMGYDNGIERAPMADVERAPDTWRTDARWPAPGTAAVTL
HPRTGTTAGVGALGTRPTPAGQTASFTDDPQLGEADWSAAVDRATPAKAG
FTTGPLTAPLRLSGAGTVTVTATPSTTSAHLTAVLVDLGPDTIRNYGGDG
EGIVTRGNSTCWGAGTTGDTGCFKETAADTSKVDHTVFSRGWADLGHATD
PQHGHPLTPGKPYTLTLQLAASDHIVPAGHRLALIVAGTDAHLIDPPASR
PTLTLDLARTAARLPLTGGAPALARATAGTPATVHPTGTALTGIAPPPAP
SRLPHGD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTIRTGTPHPPWKTLVLSAALALLALVAVPGSAGAAPAPRESKPVYSYAH
AVRETVWVDTGLDGDGDGRPDRVAADIVRPAEPARQGRRIPVIMDASPYY
SCCGRGNESQKKTYDAQGRPVQFPLFYDNYFVPRGYATVLVDLAGTNRSD
GCIDVGGRSDVQSAKAVVDWLGGRARGYTARSGGKPVTADWSNGNTGMIG
KSWDATVANGVAVTGVPGLKTIVPIAGISSWYDYYFAQGAPLYDGGPDGL
ASAVESPGAHKNCAAVQKKLVDGAPRNGDWTDLWTERDYVRNADKVRASV
FLVHGMQDLNVRTKHFGQWWDALARHGVQRKIWLSQTGHVDPFDYRRADW
VRTLHQWFDHYLMGYDNGIERAPMADVERAPDTWRTDARWPAPGTAAVTL
HPRTGTTAGVGALGTRPTPAGQTASFTDDPQLGEADWSAAVDRATPAKAG
FTTGPLTAPLRLSGAGTVTVTATPSTTSAHLTAVLVDLGPDTIRNYGGDG
EGIVTRGNSTCWGAGTTGDTGCFKETAADTSKVDHTVFSRGWADLGHATD
PQHGHPLTPGKPYTLTLQLAASDHIVPAGHRLALIVAGTDAHLIDPPASR
PTLTLDLARTAARLPLTGGAPALARATAGTPATVHPTGTALTGIAPPPAP
SRLPHGD


Reference
    Title: Biological function of the pld gene product that degrades epsilon-poly-L-lysine in Streptomyces albulus
    Hamano Y, Yoshida T, Kito M, Nakamori S, Nagasawa T, Takagi H
    Ref: Applied Microbiology & Biotechnology, 72:173, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer