Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-q5y9h1

Aeromicrobium erythreum thioesterase

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Aeromicrobium erythreum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Propionibacteriales: N E > Nocardioidaceae: N E > Aeromicrobium: N E > Aeromicrobium erythreum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AY623658
1 UniProt : Q5Y9H1
1 UniProt : Q5Y9H1
1 Interpro : Q5Y9H1
1 Prodom : Q5Y9H1
1 Pfam : Q5Y9H1
1 PIRSF : Q5Y9H1
1 SUPERFAM : Q5Y9H1
Sequence
Graphical view for this peptide sequence: 9acto-q5y9h1
Colored MSA for Thioesterase (raw)
MTDADGWLRCLRREAGASADLLCLPHAGAAADSFVALAAALAPDVELWAV
QYPGRQDRSTQEQLPTAQAIAEVVADAWRSRARTRPFAVLGHSMGALVAY
EATRLLEPAAVDAPVRLVVSGQTAPEQHAGRTDLPDDDGLLAEVRRLDPG
TVLDDEDLREHALPTLRADYRVLRDYTWDPRPLLRTPLTVLCGDADPLTP
VADAERWLALSIVPGRVRTLEGGHFFLRDHVDTVAALVREDLLD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTDADGWLRCLRREAGASADLLCLPHAGAAADSFVALAAALAPDVELWAV
QYPGRQDRSTQEQLPTAQAIAEVVADAWRSRARTRPFAVLGHSMGALVAY
EATRLLEPAAVDAPVRLVVSGQTAPEQHAGRTDLPDDDGLLAEVRRLDPG
TVLDDEDLREHALPTLRADYRVLRDYTWDPRPLLRTPLTVLCGDADPLTP
VADAERWLALSIVPGRVRTLEGGHFFLRDHVDTVAALVREDLLD


Reference
    Title: The erythromycin biosynthetic gene cluster of Aeromicrobium erythreum
    Brikun IA, Reeves AR, Cernota WH, Luu MB, Weber JM
    Ref: J Ind Microbiol Biotechnol, 31:335, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer