Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9acto-q7wz55

Nonomuraea sp. ATCC 39727 putative type II thioesterase

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Nonomuraea sp. ATCC 39727
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptosporangiales: N E > Streptosporangiaceae: N E > Nonomuraea: N E > Nonomuraea gerenzanensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AJ561198
1 UniProt : Q7WZ55
1 UniProt : Q7WZ55
1 Interpro : Q7WZ55
1 Prodom : Q7WZ55
1 Pfam : Q7WZ55
1 PIRSF : Q7WZ55
1 SUPERFAM : Q7WZ55
Sequence
Graphical view for this peptide sequence: 9acto-q7wz55
Colored MSA for Thioesterase (raw)
MSTWFRCFDRRPLATMRLICFPHAGGSAVFYRNWHRLAAPEIEVHAVQYP
GRADRLHEPLVGDAHRLAESVGRELRPLLDRPVALFGHSMGSLIAYETAR
LLTGSGIPPAHLFVSGGVAAHDRGRLAHRVAPASEEALIDRLRLLGGTDA
EALASAEFRAFALPYVRNDFQLVQSYRHTPGPPLTVPITAFTGADDPVVR
LDAVARWAELTAREFSCHVLPGGHFFLGHEQAALWAHLHARLGIATPAHC
G
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTWFRCFDRRPLATMRLICFPHAGGSAVFYRNWHRLAAPEIEVHAVQYP
GRADRLHEPLVGDAHRLAESVGRELRPLLDRPVALFGHSMGSLIAYETAR
LLTGSGIPPAHLFVSGGVAAHDRGRLAHRVAPASEEALIDRLRLLGGTDA
EALASAEFRAFALPYVRNDFQLVQSYRHTPGPPLTVPITAFTGADDPVVR
LDAVARWAELTAREFSCHVLPGGHFFLGHEQAALWAHLHARLGIATPAHC
G


Reference
    Title: The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species
    Sosio M, Stinchi S, Beltrametti F, Lazzarini A, Donadio S
    Ref: Chemical Biology, 10:541, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer