Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9alte-MGS-MT1

Alteromonas australica MGS-MT1,EH23 an alpha/beta hydrolase from a Lake Matapan deep-sea metagenome library

Comment
EH23 promiscuous activity 34/96 substrates Martinez-Martinez et al. 2018


Relationship
Family|GTSAGmotif
Block| H
Position in NCBI Life Tree|Alteromonas australica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Alteromonadaceae: N E > Alteromonas: N E > Alteromonas australica: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
4Q3O: Crystal structure of MGS-MT1, an alpha/beta hydrolase enzyme from a Lake Matapan deep-sea metagenome library
No kinetic





1 substrate:
Glucose-pentaacetate
No inhibitor
3 Genbank : KF831419, AIG00279, AJG38104
2 UniProt : A0A075P3M9, A0A0B5KQQ5
1 Structure : 4Q3O
2 UniProt : A0A075P3M9, A0A0B5KQQ5
2 Interpro : A0A075P3M9, A0A0B5KQQ5
2 Prodom : A0A075P3M9, A0A0B5KQQ5
2 Pfam : A0A075P3M9, A0A0B5KQQ5
2 PIRSF : A0A075P3M9, A0A0B5KQQ5
2 SUPERFAM : A0A075P3M9, A0A0B5KQQ5
Sequence
Graphical view for this peptide sequence: 9alte-MGS-MT1
Colored MSA for GTSAGmotif (raw)
MHRYGLLVFCSLVILMVQGVNKAVAGEQAKEVPIPQSISAEFKAALAQYP
TPSVEEARSFVPTTAAQWRDYVQATNKMQKTKIKNMRKHYGVTVELLDIK
GVTVRKITPKSLSPEFKDHVYIDIHGGAYVLFAGLPSIEEGILIAHRLGI
VVYSVDYRMPPAYPFPAALDDVKHVYRVLSQQYDANHIFMGGTSAGGGLL
LAFVQGLIENGVATPRAIYAGTPWADLTKTGDSLYTNEGIDRILITYDGT
LGASARLYAGNTPLTHPKLSPIYGDFTDFPPTFLVTGTRDMFLSDTVRVN
RKMRDAGVTTVLDVYEGLSHADYLVSHQTPESQSVYRQLKRFLVGFTN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHRYGLLVFCSLVILMVQGVNKAVAGEQAKEVPIPQSISAEFKAALAQYP
TPSVEEARSFVPTTAAQWRDYVQATNKMQKTKIKNMRKHYGVTVELLDIK
GVTVRKITPKSLSPEFKDHVYIDIHGGAYVLFAGLPSIEEGILIAHRLGI
VVYSVDYRMPPAYPFPAALDDVKHVYRVLSQQYDANHIFMGGTSAGGGLL
LAFVQGLIENGVATPRAIYAGTPWADLTKTGDSLYTNEGIDRILITYDGT
LGASARLYAGNTPLTHPKLSPIYGDFTDFPPTFLVTGTRDMFLSDTVRVN
RKMRDAGVTTVLDVYEGLSHADYLVSHQTPESQSVYRQLKRFLVGFTN


References
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Pressure adaptation is linked to thermal adaptation in salt-saturated marine habitats
    Alcaide M, Stogios PJ, Lafraya A, Tchigvintsev A, Flick R, Bargiela R, Chernikova TN, Reva ON, Hai T and Ferrer M <11 more author(s)>
    Ref: Environ Microbiol, 17:332, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer