Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9asco-a0a1b7sbk6

Ogataea polymorpha. Uncharacterized protein

Relationship
Family|ABHD11-Acetyl_transferase
Block| X
Position in NCBI Life Tree|Ogataea polymorpha
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Pichiaceae: N E > Ogataea: N E > Ogataea polymorpha: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AECK01000007, XP_018208833
1 UniProt : A0A1B7SBK6
1 UniProt : A0A1B7SBK6
1 Interpro : A0A1B7SBK6
1 Prodom : A0A1B7SBK6
1 Pfam : A0A1B7SBK6
1 PIRSF : A0A1B7SBK6
1 SUPERFAM : A0A1B7SBK6
Sequence
Graphical view for this peptide sequence: 9asco-a0a1b7sbk6
Colored MSA for ABHD11-Acetyl_transferase (raw)
MNKFETKYKFSSALDKRIPTVELAYERYSPRSPTANNPIIFLHGLFGSKA
NNRTVSKQLVNTLDRDVYCLDLRNHGDSPHNERHDYPSLAADVERFVEDH
GLIDPILIGHSMGAKTAMAVCLRRPELCSMLISVDNAPVDFTAGGTGFSK
FGIYIKQLKKIQDDPSLKNLKECDNILAQVESNLAVRQFLLTNMRKSANQ
YTSRVPLDILARSLDNISGWPFNYEISRWTRPALFIRGKQSPYIADEYLA
SVGLFFPNFVVKDVDAGHWLISERPKEFVSLVTNWVQTTEDR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNKFETKYKFSSALDKRIPTVELAYERYSPRSPTANNPIIFLHGLFGSKA
NNRTVSKQLVNTLDRDVYCLDLRNHGDSPHNERHDYPSLAADVERFVEDH
GLIDPILIGHSMGAKTAMAVCLRRPELCSMLISVDNAPVDFTAGGTGFSK
FGIYIKQLKKIQDDPSLKNLKECDNILAQVESNLAVRQFLLTNMRKSANQ
YTSRVPLDILARSLDNISGWPFNYEISRWTRPALFIRGKQSPYIADEYLA
SVGLFFPNFVVKDVDAGHWLISERPKEFVSLVTNWVQTTEDR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer