Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9asco-a0a1e3qvj2

Babjeviella inositovora NRRL Y-12698. Uncharacterized protein

Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Babjeviella inositovora NRRL Y-12698
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Babjeviella: N E > Babjeviella inositovora: N E > Babjeviella inositovora NRRL Y-12698: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : KV454427, XP_018987007.1
1 UniProt : A0A1E3QVJ2
1 UniProt : A0A1E3QVJ2
1 Interpro : A0A1E3QVJ2
1 Prodom : A0A1E3QVJ2
1 Pfam : A0A1E3QVJ2
1 PIRSF : A0A1E3QVJ2
1 SUPERFAM : A0A1E3QVJ2
Sequence
Graphical view for this peptide sequence: 9asco-a0a1e3qvj2
Colored MSA for Arb2_domain (raw)
LGDSLRTHQANTLFHNHQYITLPILESKFHATLEDQIVASPDIYDCQTIV
ISVHDPPEIWGLTDALSGTIDSINSVVVDPSQQVLEWAQARKYGVIDICV
PLHCDDDYTYNPQLAGQELLLYVWDHYLQFFQASKIAFVGVGEAYSGIVH
LLGHRDVRALVKASIGIVDKQPLRAIVPLIDENVTEWYFRNSLVFTSAKH
PCWENANGDAIKKPRKKFGRVLKGDSVGMVDIFGERFDEGCDFILDAFEE
FDSSDD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

LGDSLRTHQANTLFHNHQYITLPILESKFHATLEDQIVASPDIYDCQTIV
ISVHDPPEIWGLTDALSGTIDSINSVVVDPSQQVLEWAQARKYGVIDICV
PLHCDDDYTYNPQLAGQELLLYVWDHYLQFFQASKIAFVGVGEAYSGIVH
LLGHRDVRALVKASIGIVDKQPLRAIVPLIDENVTEWYFRNSLVFTSAKH
PCWENANGDAIKKPRKKFGRVLKGDSVGMVDIFGERFDEGCDFILDAFEE
FDSSDD



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer