Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9aspa-a0a2i0w093

Dendrobium catenatum. Uncharacterized protein

Relationship
Family|UCP031088
Block| X
Position in NCBI Life Tree|Dendrobium catenatum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > Asparagales: N E > Orchidaceae: N E > Epidendroideae: N E > Malaxideae: N E > Dendrobiinae: N E > Dendrobium: N E > Dendrobium catenatum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KZ503041
1 UniProt : A0A2I0W093
1 UniProt : A0A2I0W093
1 Interpro : A0A2I0W093
1 Prodom : A0A2I0W093
1 Pfam : A0A2I0W093
1 PIRSF : A0A2I0W093
1 SUPERFAM : A0A2I0W093
Sequence
Graphical view for this peptide sequence: 9aspa-a0a2i0w093
Colored MSA for UCP031088 (raw)
MVHVHAADLRAALQAAATACYLNPLHSWTGDDHRRKRPAARFVVLRSAIP
SRRPFSASIEPSTTAIVGGGGALSWVEKGKKPEICTADELHYVPVPGTDW
KIALWRYLPSNEAPKRNHPLMLLSGVGTNAIGFDLSPGASFARHMSKQGF
DTWIVEVRGAGLSIRAHESNETIQSSDKPSISNLDSTDEVKLTGDESQLV
TKLTSTFMNLAERLSGYLNEGQLKAISEKFLEQISKLLEDAGLAERFNEI
AAKISSLLEARQNSSVAGQLRELSQRLINTIEEGQKSVSPQLFDLQERLS
STIEDFQKQLDLIVTYDWDFDNYLEEDLPAAMEYIREHSMVKDSKLLTIG
HSMGGILLYALLSRCASQGSKCGLAAIVTLAASVDYTTSKSSLKLLLPLA
DPAQALNVPVVPLGALMTAAYPLSSRPPYVLSWVTSQVSAQDMMLPELYE
KLVLNNFCTIPAKVILQLTSAFREGGLRNRTGNFSYKDNLHKCDVPVLAL
AGDQDLICPPEAVYETVKLIPELKVSYKVFGKPDGPHYAHYDLVGGRLAT
NEVYPCIINFLCCHDELTCELSD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVHVHAADLRAALQAAATACYLNPLHSWTGDDHRRKRPAARFVVLRSAIP
SRRPFSASIEPSTTAIVGGGGALSWVEKGKKPEICTADELHYVPVPGTDW
KIALWRYLPSNEAPKRNHPLMLLSGVGTNAIGFDLSPGASFARHMSKQGF
DTWIVEVRGAGLSIRAHESNETIQSSDKPSISNLDSTDEVKLTGDESQLV
TKLTSTFMNLAERLSGYLNEGQLKAISEKFLEQISKLLEDAGLAERFNEI
AAKISSLLEARQNSSVAGQLRELSQRLINTIEEGQKSVSPQLFDLQERLS
STIEDFQKQLDLIVTYDWDFDNYLEEDLPAAMEYIREHSMVKDSKLLTIG
HSMGGILLYALLSRCASQGSKCGLAAIVTLAASVDYTTSKSSLKLLLPLA
DPAQALNVPVVPLGALMTAAYPLSSRPPYVLSWVTSQVSAQDMMLPELYE
KLVLNNFCTIPAKVILQLTSAFREGGLRNRTGNFSYKDNLHKCDVPVLAL
AGDQDLICPPEAVYETVKLIPELKVSYKVFGKPDGPHYAHYDLVGGRLAT
NEVYPCIINFLCCHDELTCELSD


References
    Title: The Apostasia genome and the evolution of orchids
    Zhang GQ, Liu KW, Li Z, Lohaus R, Hsiao YY, Niu SC, Wang JY, Lin YC, Xu Q and Liu ZJ <25 more author(s)>
    Ref: Nature, 549:379, 2017 : PubMed

            

    Title: The Dendrobium catenatum Lindl. genome sequence provides insights into polysaccharide synthase, floral development and adaptive evolution
    Zhang GQ, Xu Q, Bian C, Tsai WC, Yeh CM, Liu KW, Yoshida K, Zhang LS, Chang SB and Liu ZJ <26 more author(s)>
    Ref: Sci Rep, 6:19029, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer