Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9baci-F7lip

Bacillus tequilensis lipase LipA

Relationship
Family|Lipase_2
Block| X
Position in NCBI Life Tree|Bacillus tequilensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus tequilensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : WP_167871569, QIW78618
1 UniProt : A0A6H0WEL7
1 Interpro : A0A6H0WEL7
1 Prodom : A0A6H0WEL7
1 Pfam : A0A6H0WEL7
1 PIRSF : A0A6H0WEL7
1 SUPERFAM : A0A6H0WEL7
Sequence
Graphical view for this peptide sequence: 9baci-F7lip
Colored MSA for Lipase_2 (raw)
MKFVKSKVITLVTILMLSATSLFALQPSAKAAEHNPVVMVHGIGGASYNF
AGIKSYLVSQGWSRDKLYAVDFWDKTGTNFNNGPVLSRFVKKVLDETGAK
KVDIVAHSMGGANTLYYIKNLDGGNKIENVVTLGGANRLTTGKALPGTDP
NQKILYTSIYSSADMIVMNYISRLDGARNVQIHGVGHIGLLYSSQVNSLI
KEGLNGGGQNTNQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFVKSKVITLVTILMLSATSLFALQPSAKAAEHNPVVMVHGIGGASYNF
AGIKSYLVSQGWSRDKLYAVDFWDKTGTNFNNGPVLSRFVKKVLDETGAK
KVDIVAHSMGGANTLYYIKNLDGGNKIENVVTLGGANRLTTGKALPGTDP
NQKILYTSIYSSADMIVMNYISRLDGARNVQIHGVGHIGLLYSSQVNSLI
KEGLNGGGQNTNQ


Reference
    Title: Cloning, Characterization, and Structural Modeling of an Extremophilic Bacterial Lipase Isolated from Saline Habitats of the Thar Desert
    Verma S, Kumar R, Kumar P, Sharma D, Gahlot H, Sharma PK, Meghwanshi GK
    Ref: Appl Biochem Biotechnol, :, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer