Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9baci-a0a0g3xxb4

Geobacillus sp. 12AMOR1 Thermostable monoacylglycerol lipase GARCT_00911

Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Geobacillus sp. 12AMOR1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Geobacillus: N E > Geobacillus sp. 12AMOR1: N E


Molecular evidence
Database
No mutation
1 structure:
5XKS: Crystal structure of monoacylglycerol lipase from thermophilic Geobacillus sp. 12AMOR
No kinetic





No Substrate
No inhibitor
1 Genbank : AKM18206
1 Structure : 5XKS
Sequence
Graphical view for this peptide sequence: 9baci-a0a0g3xxb4
Colored MSA for CarbLipBact_2 (raw)
MTETYPVVKGAEPFFFEGNDIGILVLHGFTGSPQSMRPLGEAYHEAGYTV
CGPRLKGHGTHYEDMEKTTCQDWIDSVEAGYEWLKNRCGTIFVTGLSMGG
TLTLYMAEHHPEICGIAPINAAINMPALAGALAGVGDLPRFLDAIGSDIK
KPGVKELAYEKTPAASIRQIVQLMERVKTDLHKITCPAILFCSDEDHVVP
PDNAPFIYDHIASADKKLVRLPDSYHVATLDNDRQKIIDTSLAFFKKHAD
R
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTETYPVVKGAEPFFFEGNDIGILVLHGFTGSPQSMRPLGEAYHEAGYTV
CGPRLKGHGTHYEDMEKTTCQDWIDSVEAGYEWLKNRCGTIFVTGLSMGG
TLTLYMAEHHPEICGIAPINAAINMPALAGALAGVGDLPRFLDAIGSDIK
KPGVKELAYEKTPAASIRQIVQLMERVKTDLHKITCPAILFCSDEDHVVP
PDNAPFIYDHIASADKKLVRLPDSYHVATLDNDRQKIIDTSLAFFKKHAD
R


Reference
    Title: A Thermostable Monoacylglycerol Lipase from Marine Geobacillus sp. 12AMOR1: Biochemical Characterization and Mutagenesis Study
    Tang W, Lan D, Zhao Z, Li S, Li X, Wang Y
    Ref: Int J Mol Sci, 20:, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer