Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9baci-q2avg2

Bacillus weihenstephanensis KBAB4 dienelactone hydrolase

Relationship
Family|YcjY-like
Block| X
Position in NCBI Life Tree|Bacillus weihenstephanensis KBAB4
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus mycoides: N E > Bacillus mycoides KBAB4: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : WP_012260444
1 UniProt : A9VHA2
1 Interpro : A9VHA2
1 Pfam : A9VHA2
1 PIRSF : A9VHA2
1 SUPERFAM : A9VHA2
Sequence
Graphical view for this peptide sequence: 9baci-q2avg2
Colored MSA for YcjY-like (raw)
MKKQVTFKKYNLNMAGNLHLPNEMDDNKKYPALIVLHPAGGVKEQTAGLY
AQKLADEGYVALAFDAAYQGESEGLPRYLDDPTSRVEDVRAAVDYVTTLS
FVDSERIGVVGICAGGGYAIHAAQTERRIKAVVGISAADMRRTFREGWTG
EAPISSAIQTLDAVAKQRTAEANGAEPMYLSYVPHEIDENTDSETAEGYE
YYRTARAQHPNSVNKLLFSSFDKILAFTAIDEKISTLLTQPLLLVAGSKA
GTLWQSKEAYELANEPKELVVLEGGSHFDLYDISEYVDQAVVKATEFLGK
HL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKQVTFKKYNLNMAGNLHLPNEMDDNKKYPALIVLHPAGGVKEQTAGLY
AQKLADEGYVALAFDAAYQGESEGLPRYLDDPTSRVEDVRAAVDYVTTLS
FVDSERIGVVGICAGGGYAIHAAQTERRIKAVVGISAADMRRTFREGWTG
EAPISSAIQTLDAVAKQRTAEANGAEPMYLSYVPHEIDENTDSETAEGYE
YYRTARAQHPNSVNKLLFSSFDKILAFTAIDEKISTLLTQPLLLVAGSKA
GTLWQSKEAYELANEPKELVVLEGGSHFDLYDISEYVDQAVVKATEFLGK
HL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer