Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9baci-w1saf3

Bacillus vireti LMG 21834. Carboxylesterase

Relationship
Family|CarbLipBact_1
Block| X
Position in NCBI Life Tree|Bacillus vireti LMG 21834
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus vireti: N E > Bacillus vireti LMG 21834: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ALAN01000152
1 UniProt : W1SAF3
1 UniProt : W1SAF3
1 Interpro : W1SAF3
1 Prodom : W1SAF3
1 Pfam : W1SAF3
1 PIRSF : W1SAF3
1 SUPERFAM : W1SAF3
Sequence
Graphical view for this peptide sequence: 9baci-w1saf3
Colored MSA for CarbLipBact_1 (raw)
MKVTLPKPFTFKGGKRAILLLHGFTGNSADVRMLGRFLEKRGYTCHAPHY
KGHGVPPEELVHTGPEDWWQDVINGYEFLKNSGHEEIAVAGLSLGGVFSL
KLGYTVPIKAIVPMCAPMHIKSEEVMYEGILEYAREFKKREGKTDEQIEK
EMNEFKQTPMKTLKALQQLIADVRENVEMIYAPTFVVQARHDNMINTESA
NIIYNEIESVTKEIKWYEESGHVITLDKERDQLHEDIYAFLEKLDWHD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVTLPKPFTFKGGKRAILLLHGFTGNSADVRMLGRFLEKRGYTCHAPHY
KGHGVPPEELVHTGPEDWWQDVINGYEFLKNSGHEEIAVAGLSLGGVFSL
KLGYTVPIKAIVPMCAPMHIKSEEVMYEGILEYAREFKKREGKTDEQIEK
EMNEFKQTPMKTLKALQQLIADVRENVEMIYAPTFVVQARHDNMINTESA
NIIYNEIESVTKEIKWYEESGHVITLDKERDQLHEDIYAFLEKLDWHD


Reference
    Title: The nitrate-ammonifying and nosZ-carrying bacterium Bacillus vireti is a potent source and sink for nitric and nitrous oxide under high nitrate conditions
    Mania D, Heylen K, van Spanning RJ, Frostegard A
    Ref: Environ Microbiol, 16:3196, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer