Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bacl-a0a2n6sev5

Gemella sanguinis NF-kappaB-Inducing Bioactive Effector

Comment
Gemella sanguinis A0A2N6SEV5 protein identified as Mbeg1 in a functional multigenomic screening of human-associated bacteria for NF-kappaB-inducing bioactive effectors (Estrela et al.) since then family called Mbeg1-like Only 400 n-term are homologous to Mbeg1-like


Relationship
Family|Mbeg1-like
Block| X
Position in NCBI Life Tree|Gemella sanguinis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillales incertae sedis: N E > Bacillales Family XI. Incertae Sedis: N E > Gemella: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : WP_006363906, PMC52482
1 UniProt : A0A2N6SEV5
1 UniProt : A0A2N6SEV5
1 Interpro : A0A2N6SEV5
1 Prodom : A0A2N6SEV5
1 Pfam : A0A2N6SEV5
1 PIRSF : A0A2N6SEV5
1 SUPERFAM : A0A2N6SEV5
Sequence
Graphical view for this peptide sequence: 9bacl-a0a2n6sev5
Colored MSA for Mbeg1-like (raw)
MAYSDETNMNIAKEEYKNREPGYILNTEDNEYLGTLSDVNDDRTNNGEQI
YTYTRTEGSDEIVSPDAPLSEREKVEEITILYRGSTAPGIGADNEDARKD
WLNNDVPMAEKIMLGEKGATGQLEASSDYLKEMMEKYPNAKINIYGHSLG
SMDAQYALANVTDYSRIKSANIYNGPNIYSTLTEEQKINVSALYDKINNY
VDSRDLVGLGYKKGEGTVGKTYNFSGESNGINKIDQHMWGGYRFDSDGNL
IDEDGKRVKAWNKPDEIKKLQAEAKNKVRDAAINKVQGLSVDVDHDGKLD
AQFGRDKLLTTELMPGSGAGKDIVINFSSLQGLSKNLQGLLEDIKQIREL
LTKSTTTNSTVESRKANRTETLEQSIVSYLEQINLIKSIKNLDDFYTKLE
GKEKLF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAYSDETNMNIAKEEYKNREPGYILNTEDNEYLGTLSDVNDDRTNNGEQI
YTYTRTEGSDEIVSPDAPLSEREKVEEITILYRGSTAPGIGADNEDARKD
WLNNDVPMAEKIMLGEKGATGQLEASSDYLKEMMEKYPNAKINIYGHSLG
SMDAQYALANVTDYSRIKSANIYNGPNIYSTLTEEQKINVSALYDKINNY
VDSRDLVGLGYKKGEGTVGKTYNFSGESNGINKIDQHMWGGYRFDSDGNL
IDEDGKRVKAWNKPDEIKKLQAEAKNKVRDAAINKVQGLSVDVDHDGKLD
AQFGRDKLLTTELMPGSGAGKDIVINFSSLQGLSKNLQGLLEDIKQIREL
LTKSTTTNSTVESRKANRTETLEQSIVSYLEQINLIKSIKNLDDFYTKLE
GKEKLF


Reference
    Title: Functional Multigenomic Screening of Human-Associated Bacteria for NF-B-Inducing Bioactive Effectors
    Estrela AB, Nakashige TG, Lemetre C, Woodworth ID, Weisman JL, Cohen LJ, Brady SF
    Ref: MBio, 10:, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer