Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-3WYDseq

Uncultured bacteria C-terminal esterase domain of LC-Est1

Comment
Okano, H., Hong, X., Angkawidjaja, C., Kanaya, S


Relationship
Family|5_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|uncultured bacteria
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3WYD: C-terminal esterase domain of LC-Est1
No kinetic





No Substrate
No inhibitor
2 UniProt : A0A0A6YVN5, A0A097I5E9
1 Structure : 3WYD
2 UniProt : A0A0A6YVN5, A0A097I5E9
2 Interpro : A0A0A6YVN5, A0A097I5E9
2 Prodom : A0A0A6YVN5, A0A097I5E9
2 Pfam : A0A0A6YVN5, A0A097I5E9
2 PIRSF : A0A0A6YVN5, A0A097I5E9
2 SUPERFAM : A0A0A6YVN5, A0A097I5E9
Sequence
Graphical view for this peptide sequence: 9bact-3WYDseq
Colored MSA for 5_AlphaBeta_hydrolase (raw)
SGLVPRGSHMPYRLYVPTTYDGTKAFPLVIALHGMGGDENSYFDSYQRGA
FMIEAENRGYIVACPKGRQPASMYVGPAERDVMDVIAEVRRDYKIDPDRI
YMTGHSMGGYGTWSIAMNHPDVFAALAPVAGGGNPLGMANIAHIPQLVVH
GDNDKTVPVERSRVMVEAAKKHGTEIKYIEIPGGDHVSVAARTFKDVFDW
FDSHKRKRPAAKAATNK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SGLVPRGSHMPYRLYVPTTYDGTKAFPLVIALHGMGGDENSYFDSYQRGA
FMIEAENRGYIVACPKGRQPASMYVGPAERDVMDVIAEVRRDYKIDPDRI
YMTGHSMGGYGTWSIAMNHPDVFAALAPVAGGGNPLGMANIAHIPQLVVH
GDNDKTVPVERSRVMVEAAKKHGTEIKYIEIPGGDHVSVAARTFKDVFDW
FDSHKRKRPAAKAATNK


Reference
    Title: Structural and biochemical characterization of a metagenome-derived esterase with a long N-terminal extension
    Okano H, Hong X, Kanaya E, Angkawidjaja C, Kanaya S
    Ref: Protein Science, 24:93, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer