Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-H6BDX1

uncultured bacterium esterase Est22

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
5 structures (e.g. : 5HC0, 5HC2, 5HC3... more)
No kinetic





1 substrate:
Paranitrophenylbutyrate
No inhibitor
2 Genbank : AFB82695, JF766290
1 UniProt : H6BDX1
>3 Structure links 2 more: 5HC5, 5HC3, 5HC2
1 UniProt : H6BDX1
1 Interpro : H6BDX1
1 Prodom : H6BDX1
1 Pfam : H6BDX1
1 PIRSF : H6BDX1
1 SUPERFAM : H6BDX1
Sequence
Graphical view for this peptide sequence: 9bact-H6BDX1
Colored MSA for Hormone-sensitive_lipase_like (raw)
MTNKIAEDPRIDPRIKAIFSGMDLGGGGDVESREAMLEAASSEEATAVRD
GLRVFLDACDNEEIAPSAGLKIEDYEFTSEPDGNIAKIQYIRPDSTDKLP
CVYYIHGGGMQSLSCYYGNYRAWGKIIASNGVAVAMVEFRNALVPSALPE
VAPYPAGLNDCVSGVKWVASHADELGIDASRIIIAGESGGGNLTLAAGLR
LKQEGSQDLIQGLYALCPYIAGSWPSEDSPSSTENNGILLDLHNNQGAMG
YGIEAYEMRDPLAWPGFATEEDVSGLVPTFISVNECDPLRDEGINFYRLL
LRAGVSAKCRQVMGTIHGTEIFPIACPDVSRDTAASIANFCKGG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTNKIAEDPRIDPRIKAIFSGMDLGGGGDVESREAMLEAASSEEATAVRD
GLRVFLDACDNEEIAPSAGLKIEDYEFTSEPDGNIAKIQYIRPDSTDKLP
CVYYIHGGGMQSLSCYYGNYRAWGKIIASNGVAVAMVEFRNALVPSALPE
VAPYPAGLNDCVSGVKWVASHADELGIDASRIIIAGESGGGNLTLAAGLR
LKQEGSQDLIQGLYALCPYIAGSWPSEDSPSSTENNGILLDLHNNQGAMG
YGIEAYEMRDPLAWPGFATEEDVSGLVPTFISVNECDPLRDEGINFYRLL
LRAGVSAKCRQVMGTIHGTEIFPIACPDVSRDTAASIANFCKGG


References
    Title: Structural insights of a hormone sensitive lipase homologue Est22
    Huang J, Huo YY, Ji R, Kuang S, Ji C, Xu XW, Li J
    Ref: Sci Rep, 6:28550, 2016 : PubMed

            

    Title: Identification and characterization of novel esterases from a deep-sea sediment metagenome
    Jiang X, Xu X, Huo Y, Wu Y, Zhu X, Zhang X, Wu M
    Ref: Arch Microbiol, 194:207, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer