Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-MilE3

Uncultured bacterium MGS-MilE3,EH37 alpha/beta hydrolase enzyme from sediment sample of Milazzo Harbor, Italy

Comment
EH37 promiscuous activity 28/96 substrates Martinez-Martinez et al. 2018


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
5JD5: Crystal structure of MGS-MilE3, an enzyme from the metagenome of pyrene-phenanthrene enrichment culture with sediment sample of Milazzo Harbor, Italy
No kinetic





No Substrate
No inhibitor
2 Genbank : AMK51963, KR107248
1 UniProt : A0A1S5QMH0
1 Structure : 5JD5
1 UniProt : A0A1S5QMH0
1 Interpro : A0A1S5QMH0
1 Prodom : A0A1S5QMH0
1 Pfam : A0A1S5QMH0
1 PIRSF : A0A1S5QMH0
1 SUPERFAM : A0A1S5QMH0
Sequence
Graphical view for this peptide sequence: 9bact-MilE3
Colored MSA for Hormone-sensitive_lipase_like (raw)
MSGDNPFDPELYKDAAVSAETRALNTALIDLLETSDDNWDIGVEEARARR
DRGEGPFPAVPKSPRARTIQIPGKGGDIALRIIAPETPKGVYLHFHGGGW
VFGSADGQDPMLERISDTTGLVCVSVEYRLAPEHPYPAGPDDCESAALWL
VENAKREFGTDLLTIGGESAGGHLAAVTLLRMRDRHGFTGFAGANLVFGA
FDLRWTPSARSYGNDRYLILRTLDLEKFDACFLPENVDRADPDISPLMAN
LHDMPPALFTVGTDDALLDDSLFMHARWAAAGNEAELAVYPGGAHGFVAF
PGALAASAVQRMDAFLKRFTD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSGDNPFDPELYKDAAVSAETRALNTALIDLLETSDDNWDIGVEEARARR
DRGEGPFPAVPKSPRARTIQIPGKGGDIALRIIAPETPKGVYLHFHGGGW
VFGSADGQDPMLERISDTTGLVCVSVEYRLAPEHPYPAGPDDCESAALWL
VENAKREFGTDLLTIGGESAGGHLAAVTLLRMRDRHGFTGFAGANLVFGA
FDLRWTPSARSYGNDRYLILRTLDLEKFDACFLPENVDRADPDISPLMAN
LHDMPPALFTVGTDDALLDDSLFMHARWAAAGNEAELAVYPGGAHGFVAF
PGALAASAVQRMDAFLKRFTD


References
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Natural microbial diversity in superficial sediments of Milazzo Harbor (Sicily) and community successions during microcosm enrichment with various hydrocarbons
    Yakimov MM, Denaro R, Genovese M, Cappello S, D'Auria G, Chernikova TN, Timmis KN, Golyshin PN, Giluliano L
    Ref: Environ Microbiol, 7:1426, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer