Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-Q0GMU1

Uncultured bacterium esterase/lipase (estE7) gene, complete cds

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 3DNM, 3K6K
No kinetic





No Substrate
No inhibitor
1 Genbank : DQ842024
1 UniProt : Q0GMU1
2 Structure : 3K6K, 3DNM
1 UniProt : Q0GMU1
1 Interpro : Q0GMU1
1 Prodom : Q0GMU1
1 Pfam : Q0GMU1
1 PIRSF : Q0GMU1
1 SUPERFAM : Q0GMU1
Sequence
Graphical view for this peptide sequence: 9bact-Q0GMU1
Colored MSA for Hormone-sensitive_lipase_like (raw)
MASMTGGNNMGRGSMGAMDQEIGTVTDTKMDPRDFLQLLKINAEKAEKNL
PLDQKRAGMEALCERFPRAEGVELTLTDLGGVPCIRQATDGAGAAHILYF
HGGGYISGSPSTHLVLTTQLAKQSSATLWSLDYRLAPENPFPAAVDDCVA
AYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLSP
FVDLTLSRWSNSNLADRDFLAEPDTLGEMSELYVGGEDRKNPLISPVYAD
LSGLPEMLIHVGSEEALLSDSTTLAERAGAAGVSVELKIWPDMPHVFQMY
GKFVNAADISIKEICHWISARISKLAAALE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASMTGGNNMGRGSMGAMDQEIGTVTDTKMDPRDFLQLLKINAEKAEKNL
PLDQKRAGMEALCERFPRAEGVELTLTDLGGVPCIRQATDGAGAAHILYF
HGGGYISGSPSTHLVLTTQLAKQSSATLWSLDYRLAPENPFPAAVDDCVA
AYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLSP
FVDLTLSRWSNSNLADRDFLAEPDTLGEMSELYVGGEDRKNPLISPVYAD
LSGLPEMLIHVGSEEALLSDSTTLAERAGAAGVSVELKIWPDMPHVFQMY
GKFVNAADISIKEICHWISARISKLAAALE


References
    Title: Biochemical and Structural Analysis of Hormone-sensitive Lipase Homolog EstE7: Insight into the Stabilized Dimerization of HSL-Homolog Proteins
    Nam KH, Park SH, Lee WH, Hwang KY
    Ref: Bull Korean Chem Soc, 31:2627, 2010 : PubMed

            

    Title: Structural and functional analysis of a novel hormone-sensitive lipase from a metagenome library
    Nam KH, Kim MY, Kim SJ, Priyadarshi A, Kwon ST, Koo BS, Yoon SH, Hwang KY
    Ref: Proteins, 74:1036, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer